Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 8.0e-09
glioblastoma 1.100 6.5e-08
group 3 medulloblastoma 1.200 2.1e-03
malignant mesothelioma 1.800 6.4e-07
medulloblastoma, large-cell 1.100 1.1e-04
ovarian cancer 1.100 5.3e-04
pediatric high grade glioma 1.400 5.3e-08
psoriasis 1.100 6.0e-04
tuberculosis 1.200 1.1e-05

AA Sequence

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVA      1 - 70
VLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDY     71 - 140
TLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG               141 - 199
//

Text Mined References (16)

PMID Year Title