Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 8.02137061021878E-9
pediatric high grade glioma 2712 5.32089874481872E-8
malignant mesothelioma 3163 6.43056949507383E-7
glioblastoma 5572 2.47155182865603E-6
tuberculosis 1563 1.10882212681219E-5
medulloblastoma, large-cell 6234 1.0908551210823E-4
ovarian cancer 8492 3.15191697613501E-4
psoriasis 6685 5.97662396746591E-4
group 3 medulloblastoma 2254 0.00214460663163646

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis 1.100 0.001
glioblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.100 0.000
tuberculosis 1.200 0.000
pediatric high grade glioma 1.400 0.000
group 3 medulloblastoma 1.200 0.002
ovarian cancer 1.200 0.000

Synonym

Accession Q9H0A8 B2RBN4 H3BUL2 Q7L637 Q9NX43
Symbols

Gene

  Ortholog (11)

AA Sequence

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVA      1 - 70
VLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDY     71 - 140
TLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG               141 - 199
//

Text Mined References (16)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
23637203 2013 Functional interaction of COMMD3 and COMMD9 with the epithelial sodium channel.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21569246 2011 Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.
21269460 2011 Initial characterization of the human central proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
More...