Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.10
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 3.0e-06
malignant mesothelioma 3232 1.7e-05
lung cancer 4740 7.5e-03
Disease Target Count Z-score Confidence
Polydactyly 107 4.426 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.700 3.0e-06
lung cancer 1.300 7.5e-03
malignant mesothelioma 1.400 1.7e-05

Gene RIF (1)

AA Sequence

MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQC      1 - 70
PKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQV     71 - 140
LLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLR    141 - 210
KTVPPTDAKLRKKFFEKKFTEISHRILCSYNTNIEELFAEIDQCLAINRSVLQQLEEKCGHEITEEEWEK    211 - 280
IQVQALRRETHECSICLAPLSAAGGQRVGAGRRSREMALLSCSHVFHHACLLALEEFSVGDRPPFHACPL    281 - 350
CRSCYQKKILEC                                                              351 - 362
//

Text Mined References (16)

PMID Year Title