Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.10
PubTator Score 2.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
posterior fossa group B ependymoma 2.700 0.000
lung cancer 1.500 0.001

Gene RIF (1)

PMID Text
11890671 molecular cloning of a RING domain protein expressed during sperm formation

AA Sequence

MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQC      1 - 70
PKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQV     71 - 140
LLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLR    141 - 210
KTVPPTDAKLRKKFFEKKFTEISHRILCSYNTNIEELFAEIDQCLAINRSVLQQLEEKCGHEITEEEWEK    211 - 280
IQVQALRRETHECSICLAPLSAAGGQRVGAGRRSREMALLSCSHVFHHACLLALEEFSVGDRPPFHACPL    281 - 350
CRSCYQKKILEC                                                              351 - 362
//

Text Mined References (16)

PMID Year Title
25228972 2014 RING finger proteins are involved in the progression of barrett esophagus to esophageal adenocarcinoma: a preliminary study.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
19066618 2009 Mutation analysis of a large Chinese pedigree with congenital preaxial polydactyly.
17300748 2007 A single C to T transition in intron 5 of LMBR1 gene is associated with triphalangeal thumb-polysyndactyly syndrome in a Chinese family.
16646086 2006 High incidence of t(7;12)(q36;p13) in infant AML but not in infant ALL, with a dismal outcome and ectopic expression of HLXB9.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
More...