Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.10
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.29728761254274E-9
malignant mesothelioma 3163 1.67998341813607E-5
lung cancer 4473 0.00127913457535418
Disease Target Count Z-score Confidence
Polydactyly 93 4.391 2.2
Charcot-Marie-Tooth disease type 4 10 4.074 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
posterior fossa group B ependymoma 2.700 0.000
lung cancer 1.500 0.001

Synonym

Accession Q9H0A6 Q6FIB3 Q6X7T4 Q8N6V8 Q8TDG0 Q96BM5 Q9Y6U1
Symbols HSD15
LMBR2
FKSG33

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
11890671 molecular cloning of a RING domain protein expressed during sperm formation

AA Sequence

MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQC      1 - 70
PKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQV     71 - 140
LLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLR    141 - 210
KTVPPTDAKLRKKFFEKKFTEISHRILCSYNTNIEELFAEIDQCLAINRSVLQQLEEKCGHEITEEEWEK    211 - 280
IQVQALRRETHECSICLAPLSAAGGQRVGAGRRSREMALLSCSHVFHHACLLALEEFSVGDRPPFHACPL    281 - 350
CRSCYQKKILEC                                                              351 - 362
//

Text Mined References (16)

PMID Year Title
25228972 2014 RING finger proteins are involved in the progression of barrett esophagus to esophageal adenocarcinoma: a preliminary study.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
19066618 2009 Mutation analysis of a large Chinese pedigree with congenital preaxial polydactyly.
17300748 2007 A single C to T transition in intron 5 of LMBR1 gene is associated with triphalangeal thumb-polysyndactyly syndrome in a Chinese family.
16646086 2006 High incidence of t(7;12)(q36;p13) in infant AML but not in infant ALL, with a dismal outcome and ectopic expression of HLXB9.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
More...