Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H0A3 B2R8E2
Symbols TMEM191AP

Gene

 Compartment GO Term (0)

AA Sequence

MMNNTDFLMLNNPWNKLCLVSMDFCFPLDFVSNLFWIFASKFIIVTGQIKADFKRTSWEAKAEGSLEPGR      1 - 70
LKLQLASIVPLYSSLVTAGPASKIIILKRTSLPTVSPSNERAYLLPVSFTDLAHVFYLSYFSINAKSNSF     71 - 140
SLDIIIALGIPHNTQAHFNH                                                      141 - 160
//

Text Mined References (6)

PMID Year Title
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11181995 2001 The sequence of the human genome.
10591208 1999 The DNA sequence of human chromosome 22.