Property Summary

NCBI Gene PubMed Count 29
Grant Count 6
Funding $3,260,112.25
PubMed Score 65.34
PubTator Score 38.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.100 0.001
medulloblastoma, large-cell 1.100 0.003
acute quadriplegic myopathy 1.104 0.000
colon cancer 1.200 0.000
lung cancer 1.600 0.000
ovarian cancer 1.600 0.000

Gene RIF (12)

PMID Text
26362536 HIV-1 Gag interacts with NAT10 as demonstrated by proximity dependent biotinylation proteomics
25653167 Identification of NAT10 as responsible for both 18S rRNA and leucine/serine tRNA acetylation.
25411247 NAT10 is an ATP-dependent RNA acetyltransferase responsible for formation of N(4)-acetylcytidine (ac(4)C) at position 1842 in the terminal helix of mammalian 18 S rRNA.
25010285 HIV-1 Gag interacts with NAT10 as demonstrated by proximity dependent biotinylation proteomics
24982245 The subcellular redistribution of NAT10 can be induced by decreases in GSK-3b activity. This redistribution increases cancer cell motility, and is, thus, correlated with invasive potential and poorer clinical outcome
22174317 HIV-1 Gag interacts with NAT10 as demonstrated by proximity dependent biotinylation proteomics
21177859 we identified hALP, a histone acetyl-transferase as a novel t-UTP
19303003 NAT10 may play an important role in cell division through facilitating reformation of the nucleolus and midbody in the late phase of cell mitosis, and stabilization of microtubules.
18677378 hALP is a nucleolar protein, and the nucleolar localization is mediated by its carboxy terminal domain.
17631499 chromosome de-condensation needs the function of an inner nuclear membrane (INM) protein hsSUN1 and a membrane-associated histone acetyltransferase (HAT), hALP.
More...

AA Sequence

MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRK      1 - 70
KRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPNLLARTVET     71 - 140
VEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPIS    141 - 210
SHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTV    211 - 280
ALTAARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPE    281 - 350
FNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTG    351 - 420
RSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCL    421 - 490
NITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLL    491 - 560
PPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIA    561 - 630
VHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNE    631 - 700
RPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKD    701 - 770
FRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMD    771 - 840
MIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQ    841 - 910
EKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAG    911 - 980
PNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK                             981 - 1025
//

Text Mined References (34)

PMID Year Title
26882543 2016 NAT10 regulates p53 activation through acetylating p53 at K120 and ubiquitinating Mdm2.
26823802 2015 High expression of N-acetyltransferase 10: a novel independent prognostic marker of worse outcome in patients with hepatocellular carcinoma.
25653167 2015 Yeast Kre33 and human NAT10 are conserved 18S rRNA cytosine acetyltransferases that modify tRNAs assisted by the adaptor Tan1/THUMPD1.
25411247 2014 Human NAT10 is an ATP-dependent RNA acetyltransferase responsible for N4-acetylcytidine formation in 18 S ribosomal RNA (rRNA).
24982245 2014 GSK-3?-regulated N-acetyltransferase 10 is involved in colorectal cancer invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21177859 2011 hALP, a novel transcriptional U three protein (t-UTP), activates RNA polymerase I transcription by binding and acetylating the upstream binding factor (UBF).
More...