Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.53
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q9H098 A8K1P4 D3DRT2 Q5T9K7 Q5T9K8 Q6ZSI4
Symbols HITS
C10orf45

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (5)

AA Sequence

MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKE      1 - 70
EEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES              71 - 131
//

Text Mined References (16)

PMID Year Title