Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.82
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 7.49434259766531E-28
non-small cell lung cancer 2798 5.26614174964797E-10
tuberculosis 1563 5.52416976563476E-9
juvenile dermatomyositis 1189 1.51458872166376E-7
ovarian cancer 8492 1.57190433888563E-5
osteosarcoma 7933 5.0753459182692E-5
medulloblastoma 1524 6.0193482222034E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0023541688121803
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00260021972953963
primitive neuroectodermal tumor 3031 0.00631125332725916
Atopic dermatitis 944 0.00739768064191327
progressive supranuclear palsy 674 0.0148379885934919
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0181251535755885
adrenocortical carcinoma 1427 0.0202001875335318
Breast cancer 3099 0.0260219833290876
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0419919058480101

Expression

Synonym

Accession Q9H098 A8K1P4 D3DRT2 Q5T9K7 Q5T9K8 Q6ZSI4
Symbols C10orf45

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG
Horse EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG
Platypus EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

 Compartment GO Term (1)

 GWAS Trait (1)

Pathway (1)

Gene RIF (5)

PMID Text
22825356 These results show that loss of HITS (FAM107B) expression is a common phenomenon observed in cancers of distinct organs and involved in tumor development and proliferation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKE      1 - 70
EEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES              71 - 131
//

Text Mined References (16)

PMID Year Title
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
22825356 2012 Loss of HITS (FAM107B) expression in cancers of multiple organs: tissue microarray analysis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...