Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.97
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
glioblastoma 1.300 0.039
atypical teratoid / rhabdoid tumor 1.100 0.003
lung cancer -1.400 0.027
Breast cancer 2.400 0.035
invasive ductal carcinoma -1.222 0.044
nasopharyngeal carcinoma -1.700 0.000
ulcerative colitis 1.200 0.000
chronic rhinosinusitis -1.792 0.044

Synonym

Accession Q9H095 Q9BST2 Q9HAG8
Symbols DRC9
CFAP122

Gene

PDB

4LZX   4M1L  

AA Sequence

MEEDSLEDSNLPPKVWHSEMTVSVTGEPPSTVEEEGIPKETDIEIIPEIPETLEPLSLPDVLRISAVLED      1 - 70
TTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFA     71 - 140
VEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFY    141 - 210
DIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQT    211 - 280
QKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKA    281 - 350
TKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPK    351 - 420
DKVDSKDSKGKGKGKDKRRGKKK                                                   421 - 443
//

Text Mined References (9)

PMID Year Title
24787902 2014 Functional and molecular features of the calmodulin-interacting protein IQCG required for haematopoiesis in zebrafish.
24362311 2014 IQ motif-containing G (Iqcg) is required for mouse spermiogenesis.
23427265 2013 The N-DRC forms a conserved biochemical complex that maintains outer doublet alignment and limits microtubule sliding in motile axonemes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.