Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.91
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.7e-03
Breast cancer 2.400 3.5e-02
chronic rhinosinusitis -1.792 4.4e-02
ependymoma 2.800 2.8e-13
glioblastoma 1.100 3.2e-04
invasive ductal carcinoma -1.222 4.4e-02
lung cancer -1.400 2.7e-02
nasopharyngeal carcinoma -1.700 4.3e-04
ulcerative colitis 1.200 8.5e-05

AA Sequence

MEEDSLEDSNLPPKVWHSEMTVSVTGEPPSTVEEEGIPKETDIEIIPEIPETLEPLSLPDVLRISAVLED      1 - 70
TTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFA     71 - 140
VEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFY    141 - 210
DIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQT    211 - 280
QKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKA    281 - 350
TKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPK    351 - 420
DKVDSKDSKGKGKGKDKRRGKKK                                                   421 - 443
//

Text Mined References (9)

PMID Year Title