Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.97
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.26286167533674E-16
ulcerative colitis 2087 8.52250497996777E-5
nasopharyngeal carcinoma 1056 4.25300361507752E-4
atypical teratoid / rhabdoid tumor 4369 0.00272648860661714
lung cancer 4473 0.0267859445457911
Breast cancer 3099 0.0354101371960353
glioblastoma 5572 0.0391563809613744
chronic rhinosinusitis 512 0.0435885291072936
invasive ductal carcinoma 2950 0.0440393686222203
Disease Target Count
Diamond-Blackfan Anemia 5 2

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
glioblastoma 1.300 0.039
atypical teratoid / rhabdoid tumor 1.100 0.003
lung cancer -1.400 0.027
Breast cancer 2.400 0.035
invasive ductal carcinoma -1.222 0.044
nasopharyngeal carcinoma -1.700 0.000
ulcerative colitis 1.200 0.000
chronic rhinosinusitis -1.792 0.044

Synonym

Accession Q9H095 Q9BST2 Q9HAG8
Symbols DRC9
CFAP122

Gene

PDB

4LZX   4M1L  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

AA Sequence

MEEDSLEDSNLPPKVWHSEMTVSVTGEPPSTVEEEGIPKETDIEIIPEIPETLEPLSLPDVLRISAVLED      1 - 70
TTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFA     71 - 140
VEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFY    141 - 210
DIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQT    211 - 280
QKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKA    281 - 350
TKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPK    351 - 420
DKVDSKDSKGKGKGKDKRRGKKK                                                   421 - 443
//

Text Mined References (9)

PMID Year Title
24787902 2014 Functional and molecular features of the calmodulin-interacting protein IQCG required for haematopoiesis in zebrafish.
24362311 2014 IQ motif-containing G (Iqcg) is required for mouse spermiogenesis.
23427265 2013 The N-DRC forms a conserved biochemical complex that maintains outer doublet alignment and limits microtubule sliding in motile axonemes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.