Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.49
PubTator Score 33.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Disease of metabolism 15 2.0

Expression

Gene RIF (1)

PMID Text
17391723 Study shows that an NBPF gene lacking this insertion, NBPF3, is expressed in a variety of tissues; thus the effect of HERV(K) LTR insertion on NBPF gene expression remains unknown.

AA Sequence

MPLTPTVQGFQWTLRGPDVETSPFGAPRAASHGVGRHQELRDPTVPGPTSSATNVSMVVSAGPWSGEKAE      1 - 70
MNILEINKKSRPQLAENKQQFRNLKQKCLVTQVAYFLANRQNNYDYEDCKDLIKSMLRDERLLTEEKLAE     71 - 140
ELGQAEELRQYKVLVHSQERELTQLREKLQEGRDASRSLNQHLQALLTPDEPDNSQGRDLREQLAEGCRL    141 - 210
AQHLVQKLSPENDDDEDEDVKVEEAEKVQELYAPREVQKAEEKEVPEDSLEECAITCSNSHHPCESNQPY    211 - 280
GNTRITFEEDQVDSTLIDSSSHDEWLDAVCIIPENESDHEQEEEKGPVSPRNLQESEEEEAPQESWDEGD    281 - 350
WTLSIPPDMSASYQSDRSTFHSVEEQQVGLALDIGRHWCDQVKKEDQEATSPRLSRELLDEKEPEVLQDS    351 - 420
LDRFYSTPFEYLELPDLCQPYRSDFYSLQEQHLGLALDLDRMKKDQEEEEDQGPPCPRLSRELPEVVEPE    421 - 490
DLQDSLDRWYSTPFSYPELPDSCQPYGSCFYSLEEEHVGFSLDVDEIEKYQEGEEDQKPPCPRLNEVLME    491 - 560
AEEPEVLQDSLDRCYSTTSTYFQLHASFQQYRSAFYSFEEQDVSLALDVDNRFFTLTVIRHHLAFQMGVI    561 - 630
FPH                                                                       631 - 633
//

Text Mined References (22)

PMID Year Title
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
19744961 2009 Genome-wide significant predictors of metabolites in the one-carbon metabolism pathway.
19303062 2009 Genome-wide association study of vitamin B6, vitamin B12, folate, and homocysteine blood concentrations.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17391723 2007 Insertion of an HERV(K) LTR in the intron of NBPF3 is not required for its transcriptional activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...