Property Summary

Ligand Count 8
NCBI Gene PubMed Count 27
PubMed Score 54.26
PubTator Score 38.00

Knowledge Summary

Patent (3,314)

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.100 4.1e-02
Astrocytoma, Pilocytic 1.400 1.0e-03
atypical teratoid / rhabdoid tumor 3.600 2.5e-09
Breast cancer 1.400 4.5e-12
cystic fibrosis 1.200 5.4e-03
ependymoma 1.200 1.1e-04
esophageal adenocarcinoma -1.100 4.6e-02
glioblastoma 2.000 1.6e-03
interstitial cystitis 1.400 1.6e-03
intraductal papillary-mucinous adenoma (... -1.700 6.3e-03
invasive ductal carcinoma 1.500 2.1e-03
malignant mesothelioma 1.500 4.1e-07
medulloblastoma 1.400 6.2e-04
medulloblastoma, large-cell 1.600 3.0e-02
osteosarcoma -2.725 1.4e-05
ovarian cancer 1.600 1.6e-04
primitive neuroectodermal tumor 2.200 3.0e-03
psoriasis -1.600 7.3e-05
ulcerative colitis -1.400 2.4e-06

Gene RIF (15)

AA Sequence

MESLVFARRSGPTPSAAELARPLAEGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLGKGTYGKVKKA      1 - 70
RESSGRLVAIKSIRKDKIKDEQDLMHIRREIEIMSSLNHPHIIAIHEVFENSSKIVIVMEYASRGDLYDY     71 - 140
ISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGNIKIADFGLSNLYHQGKFLQTFC    141 - 210
GSPLYASPEIVNGKPYTGPEVDSWSLGVLLYILVHGTMPFDGHDHKILVKQISNGAYREPPKPSDACGLI    211 - 280
RWLLMVNPTRRATLEDVASHWWVNWGYATRVGEQEAPHEGGHPGSDSARASMADWLRRSSRPLLENGAKV    281 - 350
CSFFKQHAPGGGSTTPGLERQHSLKKSRKENDMAQSLHSDTADDTAHRPGKSNLKLPKGILKKKVSASAE    351 - 420
GVQEDPPELSPIPASPGQAAPLLPKKGILKKPRQRESGYYSSPEPSESGELLDAGDVFVSGDPKEQKPPQ    421 - 490
ASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLP    491 - 560
ERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT      561 - 628
//

Text Mined References (30)

PMID Year Title