Property Summary

NCBI Gene PubMed Count 26
Grant Count 22
R01 Count 20
Funding $2,689,199.89
PubMed Score 51.25
PubTator Score 38.00

Knowledge Summary

Patent (3,314)

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
esophageal adenocarcinoma -1.100 0.046
psoriasis -1.600 0.000
osteosarcoma -2.725 0.000
ependymoma 1.200 0.000
medulloblastoma 1.900 0.001
atypical teratoid / rhabdoid tumor 3.600 0.000
glioblastoma 2.000 0.002
medulloblastoma, large-cell 1.600 0.030
primitive neuroectodermal tumor 2.200 0.003
intraductal papillary-mucinous adenoma (... -1.700 0.006
interstitial cystitis 1.400 0.002
cystic fibrosis 1.200 0.005
pediatric high grade glioma 1.400 0.003
pilocytic astrocytoma 1.300 0.001
Breast cancer 1.400 0.000
invasive ductal carcinoma 1.500 0.002
ulcerative colitis -1.400 0.000
ovarian cancer 1.600 0.000

Gene RIF (14)

PMID Text
25832654 NUAK2 silencing and inactivation of the PI3K pathway efficiently controlled CDK2 expression, whereas CDK2 inactivation specifically abrogated the growth of NUAK2-amplified and PTEN-deficient melanoma cells.
25732129 Sucrose non-fermenting AMPK related kinase/Pentraxin 3 combined role in immunometabolic signaling and DNA damage response is proposed to accelerate cardiovascular complications in systemic lupus erythematosus patients
23831117 The AMPK-related kinase SNARK regulates hepatitis C virus replication and pathogenesis through enhancement of TGF-beta signaling.
22796592 Activation of AMP-activated protein kinase protects the integrity of the blood-brain barrier by suppressing the induction of NADPH oxidase-derived superoxide anions.
21911917 Considers possible roles of NUAK2 in tumorigenesis in general and suggest that NUAK2 has pivotal roles in acral melanomagenesis.
21460252 This study further supports the importance of NUAK2 in cancer development and tumor progression, while AMPK has antioncogenic properties.
21242312 MLCP (myosin light chain phosphatase) activation is counteracted by a previously unrecognized association between MRIP (myosin phosphatase Rho-interacting protein) and the inducible kinase NUAK2
20713714 Data show that SNARK is activated by muscle contraction and is a unique mediator of contraction-stimulated glucose transport in skeletal muscle.
19652946 Skeletal muscle SNARK expression is increased in human obesity, and in response to metabolic stressors, but not type 2 diabetes. Partial SNARK depletion failed to modify either glucose or lipid metabolism.
18992219 The nuclear localizing SNARK altered transcriptome profiles and a considerable part of these alterations were canceled by the mutation of NLS, suggesting the ability of SNARK to modulate gene expression dependent on its nuclear localization.
More...

AA Sequence

MESLVFARRSGPTPSAAELARPLAEGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLGKGTYGKVKKA      1 - 70
RESSGRLVAIKSIRKDKIKDEQDLMHIRREIEIMSSLNHPHIIAIHEVFENSSKIVIVMEYASRGDLYDY     71 - 140
ISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGNIKIADFGLSNLYHQGKFLQTFC    141 - 210
GSPLYASPEIVNGKPYTGPEVDSWSLGVLLYILVHGTMPFDGHDHKILVKQISNGAYREPPKPSDACGLI    211 - 280
RWLLMVNPTRRATLEDVASHWWVNWGYATRVGEQEAPHEGGHPGSDSARASMADWLRRSSRPLLENGAKV    281 - 350
CSFFKQHAPGGGSTTPGLERQHSLKKSRKENDMAQSLHSDTADDTAHRPGKSNLKLPKGILKKKVSASAE    351 - 420
GVQEDPPELSPIPASPGQAAPLLPKKGILKKPRQRESGYYSSPEPSESGELLDAGDVFVSGDPKEQKPPQ    421 - 490
ASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLP    491 - 560
ERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT      561 - 628
//

Text Mined References (29)

PMID Year Title
25832654 2015 NUAK2 Amplification Coupled with PTEN Deficiency Promotes Melanoma Development via CDK Activation.
25732129 2016 Sucrose non-fermenting AMPK related kinase/Pentraxin 3 and DNA damage axis: a gateway to cardiovascular disease in systemic lupus erythematosus among Egyptian patients.
23831117 2013 The AMPK-related kinase SNARK regulates hepatitis C virus replication and pathogenesis through enhancement of TGF-? signaling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22796592 2012 Activation of AMP-activated protein kinase alleviates high-glucose-induced dysfunction of brain microvascular endothelial cell tight-junction dynamics.
21911917 2011 NUAK2: an emerging acral melanoma oncogene.
21460252 2011 AMP kinase-related kinase NUAK2 affects tumor growth, migration, and clinical outcome of human melanoma.
21242312 2011 An association between NUAK2 and MRIP reveals a novel mechanism for regulation of actin stress fibers.
20713714 2010 Sucrose nonfermenting AMPK-related kinase (SNARK) mediates contraction-stimulated glucose transport in mouse skeletal muscle.
19927127 2010 Regulation of ploidy and senescence by the AMPK-related kinase NUAK1.
More...