Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 9
Funding $436,299.9
PubMed Score 7.38
PubTator Score 8.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.400 0.002
osteosarcoma -1.351 0.000
pancreatic ductal adenocarcinoma liver m... -1.058 0.028
cystic fibrosis -1.100 0.000
ovarian cancer -1.200 0.000

Gene RIF (5)

PMID Text
26975471 Arg-24 of Atg16L1 is crucial for its interaction with Atg5 which has implications in the binding of the dimeric complex to Rab33B
25439980 Analysis of hepatitis B virus capsid maturation steps revealed that Rab33B and Atg5/12/16L1 are required for proper particle assembly and/or stability.
23091056 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
22652534 A second autosomal recessive locus for Dyggve-Melchior-Clausen syndrome exists on 4q31.1 and that Rab protein-encoding gene, RAB33B, is the likely disease gene in that locus.
18448665 Rab33 modulates autophagosome formation through interaction with Atg16L

AA Sequence

MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDF      1 - 70
RERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLAND     71 - 140
IPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQP    141 - 210
PDNGIILKPEPKPAMTCWC                                                       211 - 229
//

Text Mined References (20)

PMID Year Title
26975471 2016 Deciphering the role of Atg5 in nucleotide dependent interaction of Rab33B with the dimeric complex, Atg5-Atg16L1.
25439980 2015 Rab33B and its autophagic Atg5/12/16L1 effector assist in hepatitis B virus naked capsid formation and release.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23091056 2012 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
23042644 2013 A novel RAB33B mutation in Smith-McCort dysplasia.
22899725 2012 A complete Rab screening reveals novel insights in Weibel-Palade body exocytosis.
22652534 2012 Mutation in RAB33B, which encodes a regulator of retrograde Golgi transport, defines a second Dyggve--Melchior--Clausen locus.
21808068 2011 RUTBC1 protein, a Rab9A effector that activates GTP hydrolysis by Rab32 and Rab33B proteins.
21269460 2011 Initial characterization of the human central proteome.
20163571 2010 Rab33b and Rab6 are functionally overlapping regulators of Golgi homeostasis and trafficking.
More...