Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.89
PubTator Score 8.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Smith-McCort dysplasia 3
Disease Target Count P-value
ovarian cancer 8520 2.3e-04
osteosarcoma 7950 2.8e-04
cystic fibrosis 1696 3.0e-04
psoriasis 6694 1.8e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 2.8e-02
Disease Target Count Z-score Confidence
Spondyloepimetaphyseal dysplasia 12 4.497 2.2
Disease Target Count
SMITH-MCCORT DYSPLASIA 2 1

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.100 3.0e-04
osteosarcoma -1.351 2.8e-04
ovarian cancer -1.200 2.3e-04
pancreatic ductal adenocarcinoma liver m... -1.058 2.8e-02
psoriasis -1.400 1.8e-03

Protein-protein Interaction (10)

Gene RIF (6)

AA Sequence

MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDF      1 - 70
RERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLAND     71 - 140
IPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQP    141 - 210
PDNGIILKPEPKPAMTCWC                                                       211 - 229
//

Text Mined References (21)

PMID Year Title