Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.41
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.56865484201935E-9
ovarian cancer 8492 3.7825993833993E-6
pituitary cancer 1972 7.19756554708034E-6
osteosarcoma 7933 2.29164273267445E-5
glioblastoma 5572 3.88058370023652E-5
medulloblastoma, large-cell 6234 1.62720278568181E-4
atypical teratoid / rhabdoid tumor 4369 0.00427276111573434
chronic rhinosinusitis 512 0.00651333529939069
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00698273996623548
lung cancer 4473 0.00814328861057289
medulloblastoma 1524 0.00988078472809415
tuberculosis and treatment for 6 months 686 0.010524962102959
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0107050689976284
adult high grade glioma 2148 0.0118355705060882
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0125105728857914
Pick disease 1893 0.0158243157509343
cystic fibrosis and chronic rhinosinusitis 213 0.0183270284638776
spina bifida 1064 0.0431282910081447
oligodendroglioma 2849 0.0442591581414626

Expression

Synonym

Accession Q9H079 A8KAF6 Q2TAC0 Q9H670
Symbols C15orf29

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIY      1 - 70
RRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY     71 - 140
SGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQY    141 - 210
ISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQEN    211 - 280
HLTLVPGYTGNIAKDVDAYLLQLH                                                  281 - 304
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21372175 2011 The spindle assembly function of Caenorhabditis elegans katanin does not require microtubule-severing activity.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...