Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.41
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q9H079 A8KAF6 Q2TAC0 Q9H670
Symbols C15orf29

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIY      1 - 70
RRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY     71 - 140
SGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQY    141 - 210
ISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQEN    211 - 280
HLTLVPGYTGNIAKDVDAYLLQLH                                                  281 - 304
//

Text Mined References (13)

PMID Year Title