Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.41
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIY      1 - 70
RRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY     71 - 140
SGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQY    141 - 210
ISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQEN    211 - 280
HLTLVPGYTGNIAKDVDAYLLQLH                                                  281 - 304
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21372175 2011 The spindle assembly function of Caenorhabditis elegans katanin does not require microtubule-severing activity.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...