Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.40
PubTator Score 11.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.83634990410324E-9
pilocytic astrocytoma 3086 1.08586164451798E-7
lung adenocarcinoma 2714 1.79421528412474E-6
posterior fossa group A ependymoma 1511 2.07323959729513E-5
interstitial cystitis 2299 2.12221213827484E-5
tuberculosis and treatment for 6 months 686 5.36292811625632E-5
glioblastoma 5572 8.2759985125125E-5
lung cancer 4473 1.17754461069091E-4
adult high grade glioma 2148 7.91487863046538E-4
Multiple myeloma 1328 0.00274440309213274
ductal carcinoma in situ 1745 0.00326427073345239
astrocytic glioma 2241 0.0034180842111689
oligodendroglioma 2849 0.00929486790801467
nasopharyngeal carcinoma 1056 0.0108458050050261
invasive ductal carcinoma 2950 0.0155638348286379
Breast cancer 3099 0.0463860234697696

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.332 0.003
astrocytic glioma -2.200 0.003
oligodendroglioma -1.600 0.009
glioblastoma -1.500 0.000
posterior fossa group A ependymoma -1.500 0.000
tuberculosis and treatment for 6 months 1.100 0.000
non-small cell lung cancer 1.057 0.000
lung cancer 1.400 0.000
Breast cancer 1.900 0.046
interstitial cystitis -1.200 0.000
adult high grade glioma -1.900 0.001
pilocytic astrocytoma -2.300 0.000
nasopharyngeal carcinoma 1.100 0.011
lung adenocarcinoma 1.351 0.000
ductal carcinoma in situ 1.900 0.003
invasive ductal carcinoma 2.000 0.016

Gene

PDB

1JH4   3NTW   3RK6  

  Ortholog (7)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (7)

PMID Text
25266661 Data provide evidence that the stability of Paip1 can be regulated by ubiquitin-mediated degradation, thus highlighting the importance of WWP2 as a suppressor of translation.
24396066 The Paip1-eIF3 interaction is impaired by the mTORC1 inhibitors.
21539810 the crystal structure of the middle domain of Paip1 isoform 2 (Paip1M) as determined by single-wavelength anomalous dispersion phasing is reported.
19851022 Paip1 is translational activator in 5' cap-dependent translation by interacting with PABP & initiation factors eIF4A & eIF3. Crystallization & preliminary diffraction analysis of middle domain of Paip1 gives crystals that diffract to resolution of 2.2 A.
19460752 Knockdown of poly(A) binding protein interacting protein 1 (PAIP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18725400 eIF3-Paip1 stabilizes the interaction between PABP and eIF4G, which brings about the circularization of the mRNA.
11997512 Paip1 interacts with poly(A) binding protein through two independent binding motifs.

AA Sequence

MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLRQPRTTPPPGA      1 - 70
QCEVPASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGY     71 - 140
SSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATS    141 - 210
IPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLN    211 - 280
LEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIE    281 - 350
NVVLDANCSRDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQ    351 - 420
EKYQELLEREDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ               421 - 479
//

Text Mined References (22)

PMID Year Title
25266661 2014 Paip1, an effective stimulator of translation initiation, is targeted by WWP2 for ubiquitination and degradation.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21539810 2011 Crystal structure of the middle domain of human poly(A)-binding protein-interacting protein 1.
21269460 2011 Initial characterization of the human central proteome.
19851022 2009 Crystallization and preliminary X-ray diffraction analysis of the middle domain of Paip1.
18725400 2008 Poly(A)-binding protein-interacting protein 1 binds to eukaryotic translation initiation factor 3 to stimulate translation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...