Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.72
PubTator Score 11.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 7.9e-04
astrocytic glioma -2.200 3.4e-03
Astrocytoma, Pilocytic -2.300 1.0e-07
Breast cancer 1.900 4.6e-02
ductal carcinoma in situ 1.900 3.3e-03
ependymoma -1.400 1.8e-04
glioblastoma -1.200 1.8e-04
interstitial cystitis -1.200 2.1e-05
invasive ductal carcinoma 2.000 1.6e-02
lung adenocarcinoma 1.351 1.8e-06
lung cancer 1.400 1.2e-04
Multiple myeloma 1.332 2.7e-03
nasopharyngeal carcinoma 1.100 1.1e-02
non-small cell lung cancer 1.057 1.8e-09
oligodendroglioma -1.600 9.3e-03
tuberculosis and treatment for 6 months 1.100 5.4e-05

Gene RIF (7)

AA Sequence

MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLRQPRTTPPPGA      1 - 70
QCEVPASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGY     71 - 140
SSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATS    141 - 210
IPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLN    211 - 280
LEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIE    281 - 350
NVVLDANCSRDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQ    351 - 420
EKYQELLEREDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ               421 - 479
//

Text Mined References (22)

PMID Year Title