Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.47
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.75650092311318E-14
lung adenocarcinoma 2714 2.18477874616048E-7
nasopharyngeal carcinoma 1056 1.58935772920383E-5
group 3 medulloblastoma 2254 7.0505222414294E-4
atypical teratoid / rhabdoid tumor 4369 0.0108635680373223
chronic rhinosinusitis 512 0.0488061976954328
Disease Target Count Z-score Confidence
Sinusitis 30 3.235 1.6

Expression

  Differential Expression (6)

Synonym

Accession Q9H069 A8KAE6 Q86SF9 Q86W73 Q8IWG0
Symbols LRRC48
CFAP134

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKL      1 - 70
QLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGN     71 - 140
NRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSID    141 - 210
ELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKF    211 - 280
VIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKM    281 - 350
ILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEIS    351 - 420
ISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIHKD    421 - 490
EIMRNRKRVKEINQYIDHMQSELDNLECGDILD                                         491 - 523
//

Text Mined References (15)

PMID Year Title
26387594 2015 Loss-of-Function GAS8 Mutations Cause Primary Ciliary Dyskinesia and Disrupt the Nexin-Dynein Regulatory Complex.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23354437 2013 The nexin-dynein regulatory complex subunit DRC1 is essential for motile cilia function in algae and humans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...