Property Summary

NCBI Gene PubMed Count 25
Grant Count 30
R01 Count 30
Funding $5,917,191.59
PubMed Score 60.54
PubTator Score 33.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 0.000

Gene RIF (16)

PMID Text
26067234 These results reveal a novel mechanism by which MAF1 and Pol III regulate the activity of the CDKN1A-encoding gene transcribed by Pol II.
26030842 MAF1, RNF7 and SETD3 are identified as PCNA-associated proteins in human cells and given this interaction with PCNA, Maf1, RNF7, and SetD3 are potentially involved in DNA replication, DNA repair, or associated processes.
25568945 Studies on Maf1 regulation up until now have focused on posttranslational mechanisms, notably phosphorylation, which controls Maf1 localization (in yeast) and its interaction with the polymerase (in yeast and humans)
25502566 novel role for Maf1 in suppressing both lipid biogenesis and tumor formation; Maf1 elicits these biological responses through its ability to repress genes that that synthesize lipids and regulate biosynthetic capacity.
23673667 SUMOylation has a role in controlling Maf1 and RNA pol III-mediated transcription
22810236 Recovery of RNA polymerase III transcription from the glycerol-repressed state: revisiting the role of protein kinase CK2 in Maf1 phosphoregulation.
21428925 The TOR pathway controls another aspect of Pol III transcription that is closely linked to MAF1, as it depends on the presence of MAF1.
21383183 an important role of CK2-mediated Maf1 phosphorylation in triggering Pol III activation.
20817737 Data relate Pol III transcription inhibition to Maf1 structural changes.
20543138 Maf1, a repressor that binds and inhibits pol III, is phosphorylated in a mTOR-dependent manner both in vitro and in vivo at serine 75, a site that contributes to its function as a transcriptional inhibitor.
More...

AA Sequence

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPS      1 - 70
RLSKSQGGEEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLFSAVR     71 - 140
EDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGST    141 - 210
YTPSEAGNELDMELGEEEVEEESRSGGSGAEETSTMEEDRVPVICI                            211 - 256
//

Text Mined References (33)

PMID Year Title
26067234 2015 MAF1 represses CDKN1A through a Pol III-dependent mechanism.
26030842 2015 A fluorescent bimolecular complementation screen reveals MAF1, RNF7 and SETD3 as PCNA-associated proteins in human cells.
25568945 2015 Regulating maf1 expression and its expanding biological functions.
25502566 2014 Maf1 is a novel target of PTEN and PI3K signaling that negatively regulates oncogenesis and lipid metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23673667 2013 Covalent small ubiquitin-like modifier (SUMO) modification of Maf1 protein controls RNA polymerase III-dependent transcription repression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22810236 2012 Recovery of RNA polymerase III transcription from the glycerol-repressed state: revisiting the role of protein kinase CK2 in Maf1 phosphoregulation.
21428925 2011 MAF1: a new target of mTORC1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...