Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.83
PubTator Score 9.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
hereditary spastic paraplegia -1.293 6.8e-03
ovarian cancer -1.600 1.7e-04
pancreatic ductal adenocarcinoma liver m... -2.832 7.6e-03

Gene RIF (5)

AA Sequence

MENHKSNNKENITIVDISRKINQLPEAERNLLENGSVYVGLNAALCGLIANSLFRRILNVTKARIAAGLP      1 - 70
MAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPH     71 - 140
KGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH                   141 - 195
//

Text Mined References (17)

PMID Year Title