Property Summary

NCBI Gene PubMed Count 21
Grant Count 16
R01 Count 2
Funding $2,160,427.67
PubMed Score 150.61
PubTator Score 13.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.794 0.000
group 3 medulloblastoma 1.100 0.003
posterior fossa group B ependymoma 1.400 0.000

Gene RIF (9)

PMID Text
26002196 USP1, p21 and Spartan are translesion DNA synthesis regulators. (Review)
25261934 Mutations in SPRTN cause early onset hepatocellular carcinoma, genomic instability and progeroid features.
23254330 The results suggest that Spartan negatively regulates POLD3 function in Rev1/Pol zeta-dependent translesion synthesis.
23042607 DVC1 (C1orf124) recruits the p97 protein segregase to sites of DNA damage.
23042605 DVC1 (C1orf124) is a DNA damage-targeting p97 adaptor that promotes ubiquitin-dependent responses to replication blocks.
22987070 Authors propose that Spartan promotes genomic stability by regulating the choice of rescue of stalled replication fork, whose mechanism includes its interaction with ubiquitin-conjugated PCNA and protection against PCNA deubiquitylation.
22902628 C1orf124 acts at multiple steps in TLS, stabilizes RAD18 and ubiquitinated PCNA at damage sites, and facilitates the switch from replicative to TLS polymerase to bypass DNA lesion.
22894931 Spartan is recruited to sites of stalled replication via ubiquitinated PCNA and plays an important role to prevent mutations associated with replication of damaged DNA.
22681887 Spartan promotes an unexpected feed-forward loop to enhance PCNA ubiquitylation and translesion DNA synthesis.

AA Sequence

MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSV      1 - 70
RMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHR     71 - 140
INSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYI    141 - 210
KIKEPENYSKKGKGKAKLGKEPVLAAENKDKPNRGEAQLVIPFSGKGYVLGETSNLPSPGKLITSHAINK    211 - 280
TQDLLNQNHSANAVRPNSKIKVKFEQNGSSKNSHLVSPAVSNSHQNVLSNYFPRVSFANQKAFRGVNGSP    281 - 350
RISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDTFPNKRPRLEDKTVFDNF    351 - 420
FIKKEQIKSSGNDPKYSTTTAQNSSSSSSQSKMVNCPVCQNEVLESQINEHLDWCLEGDSIKVKSEESL     421 - 489
//

Text Mined References (29)

PMID Year Title
27084448 2016 Crystal structure of human PCNA in complex with the PIP box of DVC1.
26002196 2015 The identification of translesion DNA synthesis regulators: Inhibitors in the spotlight.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25501849 2014 Spartan deficiency causes genomic instability and progeroid phenotypes.
25496645 2015 DNA-protein crosslink repair: proteases as DNA repair enzymes.
25261934 2014 Mutations in SPRTN cause early onset hepatocellular carcinoma, genomic instability and progeroid features.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23254330 2013 Regulation of error-prone translesion synthesis by Spartan/C1orf124.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042607 2012 DVC1 (C1orf124) recruits the p97 protein segregase to sites of DNA damage.
More...