Property Summary

NCBI Gene PubMed Count 26
PubMed Score 155.68
PubTator Score 13.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.5e-03
osteosarcoma -1.794 2.6e-07
posterior fossa group B ependymoma 1.400 4.3e-06

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (15)

AA Sequence

MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSV      1 - 70
RMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHR     71 - 140
INSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYI    141 - 210
KIKEPENYSKKGKGKAKLGKEPVLAAENKDKPNRGEAQLVIPFSGKGYVLGETSNLPSPGKLITSHAINK    211 - 280
TQDLLNQNHSANAVRPNSKIKVKFEQNGSSKNSHLVSPAVSNSHQNVLSNYFPRVSFANQKAFRGVNGSP    281 - 350
RISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDTFPNKRPRLEDKTVFDNF    351 - 420
FIKKEQIKSSGNDPKYSTTTAQNSSSSSSQSKMVNCPVCQNEVLESQINEHLDWCLEGDSIKVKSEESL     421 - 489
//

Text Mined References (35)

PMID Year Title