Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.305 3.8e-03

Synonym

Accession Q9H019 A6NCB4 B7WNV5 D3DPJ4 Q63HP1 Q7Z2S7 Q9NUI7
Symbols FAM54B
MST116
MSTP116
HYST1888

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAA      1 - 70
DEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRS     71 - 140
QIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSAS    141 - 210
PECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKF    211 - 280
ALKEEDISRKGN                                                              281 - 292
//

Text Mined References (25)

PMID Year Title