Property Summary

NCBI Gene PubMed Count 128
PubMed Score 1238.92
PubTator Score 142.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ulcerative colitis -1.400 6.9e-03
Astrocytoma, Pilocytic 1.100 3.1e-05
chronic rhinosinusitis -1.814 1.1e-02
cystic fibrosis 1.726 1.6e-04
ependymoma 1.100 4.7e-04
interstitial cystitis 1.100 3.8e-03
lung carcinoma -1.200 1.4e-04
nasopharyngeal carcinoma -2.000 1.8e-05
osteosarcoma -4.464 3.0e-06
pituitary cancer 2.000 5.6e-05
psoriasis -1.400 4.5e-04
tuberculosis -1.400 1.1e-03

Gene RIF (131)

AA Sequence

MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLR      1 - 70
LRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNW     71 - 140
KVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQTGFSFLQIFSISWEMFTVLFVIVGMGQISN    141 - 210
YVVAFILGTEILGKSVRIIFSTLGVCTFFAVGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPES    211 - 280
PRWLISQRRFREAEDIIQKAAKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWM    281 - 350
LTSVGYFALSLDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV    351 - 420
DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVYLGAYNRMLPY    421 - 490
IVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITAF             491 - 551
//

Text Mined References (129)

PMID Year Title