Property Summary

NCBI Gene PubMed Count 39
Grant Count 10
R01 Count 6
Funding $917,948.83
PubMed Score 41.77
PubTator Score 34.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26823772 these findings suggested that miR-145 functions as a tumor suppressor in RB by directly targeting ADAM19 in retinoblastoma cells
25799050 miR-30c inhibited colon cancer cells via targeting ADAM19.
25475731 MiR-153 has a role in inhibiting migration and invasion of human non-small-cell lung cancer by targeting ADAM19
25114068 four suggestive loci (PAX3, CCRN4L, PIGQ, and ADAM19)determinants of disease progression in Alzheimer's disease.
24951661 ADAM19 rs1422795 and HTR4 rs11168048 are associated with pulmonary function.
23429442 ADAM19 was upregulated in patients with ulcerative colitis and, to a lesser extent, in patients with Crohn's disease compared with normal controls. In contrast, ADAM9 and ADAM10 expression did not differ between patients with IBD and controls.
21270819 Prorenin receptor is mainly localized in the subcellular organelles, such as the endoplasmic reticulum and Golgi apparatus, and the prorenin receptor is cleaved by ADAM19 in the Golgi, resulting in two fragments.
21239057 Single nucleotide polymorphisms in ADAM19 gene is associated with lymphoma.
20460109 These findings suggest that ADAM19 autolysis is activated by lipopolysaccharide and that ADAM19 promotes the secretion of CRIP2.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MPGGAGAARLCLLAFALQPLRPRAAREPGWTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVM      1 - 70
AEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETELSSVTLSTCRGIRGLIT     71 - 140
VSSNLSYVIEPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMK    141 - 210
YVELYLVADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLW    211 - 280
SFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHN    281 - 350
FGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG    351 - 420
NGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGK    421 - 490
SPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNG    491 - 560
EHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGT    561 - 630
KCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESV    631 - 700
GPVVAGVLVAILVLAVLMLMYYCCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTP    701 - 770
QGKRKVINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI    771 - 840
PPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKVSPREALKV    841 - 910
KAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPA                             911 - 955
//

Text Mined References (43)

PMID Year Title
26823772 2015 MiR-145 suppressed human retinoblastoma cell proliferation and invasion by targeting ADAM19.
25799050 2015 Role of microRNA-30c targeting ADAM19 in colorectal cancer.
25475731 2015 MiR-153 inhibits migration and invasion of human non-small-cell lung cancer by targeting ADAM19.
25114068 2015 Genetic determinants of disease progression in Alzheimer's disease.
24951661 2014 ADAM19 and HTR4 variants and pulmonary function: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23429442 2013 High expression of the "A Disintegrin And Metalloprotease" 19 (ADAM19), a sheddase for TNF-? in the mucosa of patients with inflammatory bowel diseases.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
21270819 2011 The (pro)renin receptor is cleaved by ADAM19 in the Golgi leading to its secretion into extracellular space.
21239057 2011 Polymorphisms in integrin genes and lymphoma risk.
More...