Property Summary

NCBI Gene PubMed Count 39
PubMed Score 41.77
PubTator Score 34.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.500 2.1e-07
oligodendroglioma -1.100 9.9e-04
cutaneous lupus erythematosus 2.300 8.8e-04
psoriasis -2.000 2.1e-04
osteosarcoma -2.169 3.0e-04
non diabetic and post-ischemic heart fai... -1.200 2.1e-02
interstitial cystitis 1.700 1.3e-03
posterior fossa group B ependymoma -1.400 7.7e-08
primary Sjogren syndrome 1.400 1.9e-03
inflammatory breast cancer 1.800 2.7e-03
lung carcinoma -1.100 1.0e-09
gastric carcinoma 1.200 2.4e-02
mucosa-associated lymphoid tissue lympho... 1.187 1.9e-02
ductal carcinoma in situ 1.400 1.6e-03
ulcerative colitis 1.800 1.8e-05
ovarian cancer 1.100 6.6e-03
head and neck cancer and chronic obstruc... 1.100 7.3e-03

 CSPA Cell Line (1)

Gene RIF (24)

PMID Text
26823772 these findings suggested that miR-145 functions as a tumor suppressor in RB by directly targeting ADAM19 in retinoblastoma cells
25799050 miR-30c inhibited colon cancer cells via targeting ADAM19.
25475731 MiR-153 has a role in inhibiting migration and invasion of human non-small-cell lung cancer by targeting ADAM19
25114068 four suggestive loci (PAX3, CCRN4L, PIGQ, and ADAM19)determinants of disease progression in Alzheimer's disease.
24951661 ADAM19 rs1422795 and HTR4 rs11168048 are associated with pulmonary function.
23429442 ADAM19 was upregulated in patients with ulcerative colitis and, to a lesser extent, in patients with Crohn's disease compared with normal controls. In contrast, ADAM9 and ADAM10 expression did not differ between patients with IBD and controls.
21270819 Prorenin receptor is mainly localized in the subcellular organelles, such as the endoplasmic reticulum and Golgi apparatus, and the prorenin receptor is cleaved by ADAM19 in the Golgi, resulting in two fragments.
21239057 Single nucleotide polymorphisms in ADAM19 gene is associated with lymphoma.
20460109 These findings suggest that ADAM19 autolysis is activated by lipopolysaccharide and that ADAM19 promotes the secretion of CRIP2.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19727588 ADAM19 may participate in the coordinated regulation of human trophoblast cell behaviors during the process of placentation.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19079262 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18714391 we suggest that epigenetic dysregulation of ADAM19 may contribute to the neoplastic process in ovarian cancer.
18458692 ADAM19 correlates with the progress and prognosis of endometrial carcinoma.
17112471 results suggest that ADAM19 has a constitutive alpha-secretase activity for amyloid precursor protein
16827870 ADAM19 may have a modulatory role in the dysfunctional renal allograft state
15896713 ChIP assays demonstrated high levels of acetylated histone H3 in the promoter region of the MADDAM gene in TSA-treated THP-1 cells/dendritic cells compared to macrophages, indicating an important role of histone acetylation in regulating the MADDAM gene.
15242783 A new autolytic processing site at Lys543-Val544 was identified in soluble mutants of ADAM19 when these cysteine residues were individually mutated to serine residues.
12463424 yeast two-hybrid screen performed in fetal brain cDNA library isolated four proteins that interact with the cytoplasmic tail of ADAM19
12393862 investigation of proteolytic activity
12006600 activation by furin via one of two consecutive recognition sites

AA Sequence

MPGGAGAARLCLLAFALQPLRPRAAREPGWTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVM      1 - 70
AEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETELSSVTLSTCRGIRGLIT     71 - 140
VSSNLSYVIEPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMK    141 - 210
YVELYLVADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLW    211 - 280
SFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHN    281 - 350
FGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG    351 - 420
NGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGK    421 - 490
SPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNG    491 - 560
EHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGT    561 - 630
KCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESV    631 - 700
GPVVAGVLVAILVLAVLMLMYYCCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTP    701 - 770
QGKRKVINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI    771 - 840
PPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKVSPREALKV    841 - 910
KAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPA                             911 - 955
//

Text Mined References (43)

PMID Year Title
26823772 2015 MiR-145 suppressed human retinoblastoma cell proliferation and invasion by targeting ADAM19.
25799050 2015 Role of microRNA-30c targeting ADAM19 in colorectal cancer.
25475731 2015 MiR-153 inhibits migration and invasion of human non-small-cell lung cancer by targeting ADAM19.
25114068 2015 Genetic determinants of disease progression in Alzheimer's disease.
24951661 2014 ADAM19 and HTR4 variants and pulmonary function: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23429442 2013 High expression of the "A Disintegrin And Metalloprotease" 19 (ADAM19), a sheddase for TNF-? in the mucosa of patients with inflammatory bowel diseases.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
21270819 2011 The (pro)renin receptor is cleaved by ADAM19 in the Golgi leading to its secretion into extracellular space.
21239057 2011 Polymorphisms in integrin genes and lymphoma risk.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20460109 2010 ADAM19 autolysis is activated by LPS and promotes non-classical secretion of cysteine-rich protein 2.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19727588 2009 Dynamic change of Adamalysin 19 (ADAM19) in human placentas and its effects on cell invasion and adhesion in human trophoblastic cells.
19601835 2009 ADAM19/adamalysin 19 structure, function, and role as a putative target in tumors and inflammatory diseases.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19079262 2009 New sequence variants associated with bone mineral density.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
18714391 2008 Aberrant transforming growth factor beta1 signaling and SMAD4 nuclear translocation confer epigenetic repression of ADAM19 in ovarian cancer.
18458692 2008 [Expression and clinical significance of ADAM19 in endometrial carcinoma].
17112471 2007 ADAM19 is tightly associated with constitutive Alzheimer's disease APP alpha-secretase in A172 cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16827870 2006 Upregulation of ADAM19 in chronic allograft nephropathy.
16772875 2006 Metalloproteinase disintegrins ADAM8 and ADAM19 are highly regulated in human primary brain tumors and their expression levels and activities are associated with invasiveness.
15896713 2005 Epigenetic regulation of the dendritic cell-marker gene ADAM19.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15242783 2004 Evidence for disulfide involvement in the regulation of intramolecular autolytic processing by human adamalysin19/ADAM19.
14719095 2004 Increased mRNA expression of ADAMs in renal cell carcinoma and their association with clinical outcome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12615925 2003 The adaptor protein fish associates with members of the ADAMs family and localizes to podosomes of Src-transformed cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463424 2002 Screen and identification of proteins interacting with ADAM19 cytoplasmic tail.
12393862 2002 Autolytic processing at Glu586-Ser587 within the cysteine-rich domain of human adamalysin 19/disintegrin-metalloproteinase 19 is necessary for its proteolytic activity.
12058067 2002 Extracellular signal-regulated kinase phosphorylates tumor necrosis factor alpha-converting enzyme at threonine 735: a potential role in regulated shedding.
12006600 2002 Intracellular activation of human adamalysin 19/disintegrin and metalloproteinase 19 by furin occurs via one of the two consecutive recognition sites.
11708814 2001 Inhibitory antibodies against endopeptidase activity of human adamalysin 19.
11162584 2001 Expression and enzymatic activity of human disintegrin and metalloproteinase ADAM19/meltrin beta.
10887142 2000 Molecular cloning and characterization of a human metalloprotease disintegrin--a novel marker for dendritic cell differentiation.
9806848 1998 Chromosomal assignment of two ADAM genes, TACE (ADAM17) and MLTNB (ADAM19), to human chromosomes 2 and 5, respectively, and of Mltnb to mouse chromosome 11.
9461614 1998 Cloning and initial characterization of mouse meltrin beta and analysis of the expression of four metalloprotease-disintegrins in bone cells.
8358434 1993 3,400 new expressed sequence tags identify diversity of transcripts in human brain.