Property Summary

NCBI Gene PubMed Count 11
PubMed Score 58.80
PubTator Score 98.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.600 3.0e-02

Gene RIF (3)

AA Sequence

MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQS      1 - 70
RSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAA     71 - 140
EKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAI    141 - 210
MELTV                                                                     211 - 215
//

Text Mined References (12)

PMID Year Title