Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 4
Funding $1,630,999.67
PubMed Score 53.68
PubTator Score 98.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.600 0.030

Gene RIF (3)

PMID Text
23657466 Alpha-nac is a potent inducer of a Th1 response via IL12 and TLR2.
20546612 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of nascent polypeptide-associated complex alpha subunit 2 (NACA2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQS      1 - 70
RSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAA     71 - 140
EKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAI    141 - 210
MELTV                                                                     211 - 215
//

Text Mined References (12)

PMID Year Title
23989986 2014 A meta-analysis of genome-wide association studies identifies novel variants associated with osteoarthritis of the hip.
23657466 2013 The human skin-associated autoantigen ?-NAC activates monocytes and dendritic cells via TLR-2 and primes an IL-12-dependent Th1 response.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406326 2002 Characterization of a novel isoform of alpha-nascent polypeptide-associated complex as IgE-defined autoantigen.
More...