Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.01
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.500 4.9e-06
glioblastoma -1.300 2.0e-04
group 3 medulloblastoma -2.600 1.8e-04
lung carcinoma 1.600 3.1e-39
non primary Sjogren syndrome sicca 1.300 1.4e-02
osteosarcoma -1.914 1.4e-04
pediatric high grade glioma -1.300 2.7e-04
psoriasis -1.100 5.1e-03
subependymal giant cell astrocytoma -1.511 1.2e-02

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQR      1 - 70
LGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQ     71 - 140
VLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAV    141 - 210
MIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK              211 - 270
//

Text Mined References (18)

PMID Year Title