Property Summary

NCBI Gene PubMed Count 12
Grant Count 9
R01 Count 9
Funding $292,137.1
PubMed Score 9.47
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 0.005
glioblastoma -1.300 0.000
osteosarcoma -1.914 0.000
group 3 medulloblastoma -2.600 0.000
pediatric high grade glioma -1.300 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
non primary Sjogren syndrome sicca 1.300 0.014
subependymal giant cell astrocytoma -1.511 0.012
lung carcinoma 1.600 0.000

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18268499 Lhpp or a product of a collinear brain-specific transcript, therefore, may interact with Htr1a in the pathogenesis of major depression
18268499 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQR      1 - 70
LGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQ     71 - 140
VLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAV    141 - 210
MIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK              211 - 270
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18268499 2009 Evidence for HTR1A and LHPP as interacting genetic risk factors in major depression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16430861 2006 Expression of new human inorganic pyrophosphatase in thyroid diseases: its intimate association with hyperthyroidism.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...