Property Summary

NCBI Gene PubMed Count 27
PubMed Score 9.23
PubTator Score 8.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.038 0.009
pancreatic ductal adenocarcinoma liver m... -1.271 0.022
lung cancer 1.300 0.005
Pick disease -1.500 0.000
progressive supranuclear palsy -1.100 0.043
ovarian cancer 1.900 0.000

Synonym

Accession Q9GZZ9 A6NJL3 D3DNC8 Q96ST1 Ubiquitin-activating enzyme 5
Symbols EIEE44
SCAR24
THIFP1
UBE1DC1

Gene

PANTHER Protein Class (1)

PDB

5HKH   5L95   3GUC   3H8V  

Gene RIF (7)

PMID Text
26929408 study provides important structural and functional insights into the interaction between UBA5 and Ub-like modifiers, improving the understanding of the biology of the ufmylation pathway.
26872069 The study of UBA5-R246X revealed a dramatically decreased half-life and loss of UFM1 activation due to the absence of the catalytic cysteine Cys250.
25084390 Uba5 residues 364-404 were demonstrated to be necessary for the transthiolation of Ufm1 to Ufc1, and Uba5 381-404 was identified to be the minimal region for Ufc1 recognition
24966333 binding of ATP to Uba5 approximately Ufm1 thioester was required for efficient transfer of Ufm1 from Uba5 to Ufc1 via transthiolation.
24915089 Crystallization of Uba5 residues 57-363 was performed at 277 K using PEG 3350 as the precipitant, and crystals optimized by microseeding diffracted to 2.95 A resolution, with unit-cell parameters a=b=97.66, c=144.83 A, alpha=beta=90, gamma=120 degrees .
20368332 Studies reveal structural features of UBA5 that further understanding of the enzyme reaction mechanism and provide insight into the evolution of ubiquitin activation.
18442052 UBE1DC1 greatly activated SUMO2 in the nucleus or transferred activated-SUMO2 to nucleus after it conjugated SUMO2 in the cytoplasm.

AA Sequence

MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK      1 - 70
IRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINP     71 - 140
DVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN    141 - 210
AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS    211 - 280
FYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVS    281 - 350
EEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM                    351 - 404
//

Text Mined References (33)

PMID Year Title
27545681 2016 Biallelic Variants in UBA5 Reveal that Disruption of the UFM1 Cascade Can Result in Early-Onset Encephalopathy.
26929408 2016 Structural and Functional Analysis of a Novel Interaction Motif within UFM1-activating Enzyme 5 (UBA5) Required for Binding to Ubiquitin-like Proteins and Ufmylation.
26872069 2016 UBA5 Mutations Cause a New Form of Autosomal Recessive Cerebellar Ataxia.
25416956 2014 A proteome-scale map of the human interactome network.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25084390 2014 Characterization, crystallization and preliminary X-ray crystallographic analysis of the human Uba5 C-terminus-Ufc1 complex.
24966333 2014 Mechanistic study of Uba5 enzyme and the Ufm1 conjugation pathway.
24915089 2014 Characterization, crystallization and preliminary X-ray crystallographic analysis of the Uba5 fragment necessary for high-efficiency activation of Ufm1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
More...