Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.99
PubTator Score 8.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.300 5.2e-03
Multiple myeloma 1.038 9.4e-03
ovarian cancer 1.900 3.0e-05
pancreatic ductal adenocarcinoma liver m... -1.271 2.2e-02
Pick disease -1.300 2.6e-05
progressive supranuclear palsy -1.100 4.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (10)

AA Sequence

MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK      1 - 70
IRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINP     71 - 140
DVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN    141 - 210
AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS    211 - 280
FYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVS    281 - 350
EEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM                    351 - 404
//

Text Mined References (36)

PMID Year Title