Property Summary

NCBI Gene PubMed Count 40
PubMed Score 25.96
PubTator Score 30.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.5e-25
Disease Target Count Z-score Confidence
Blepharitis 23 4.581 2.3
Dry eye syndrome 18 3.953 2.0
Dacryoadenitis 10 3.314 1.7

Synonym

Accession Q9GZZ8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (40)

AA Sequence

MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQG      1 - 70
TAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA       71 - 138
//

Text Mined References (41)

PMID Year Title