Property Summary

NCBI Gene PubMed Count 39
Grant Count 25
R01 Count 18
Funding $1,895,910.36
PubMed Score 25.81
PubTator Score 30.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (39)

PMID Text
26670139 cytoprotective effect of lacritin is mediated through Cyclooxygenase-2 (COX-2).
24942736 the C terminus of lacritin is multifunctional by dose and proteolytic processing and appears to play a key role in the innate protection of the eye
23769845 Genomic analysis expands the number of predicted lacritin orthologs, and suggests that secondary structure may be largely conserved. All currently known tear proteins predicted to be extracellular by GEO are assembled, and functions summarized.
23748026 Lacritin is a component of vampire bat saliva, as detected by mass spectrometry.
23640897 Lacritin rapidly and transiently accelerates autophagy to rid stressed cells of aggregated proteins. Lacritin also restores oxidative phosphorylation. LC3-II, in the absence of autophagic inhibitor, decreases as a consequence of rapidly increased flux.
23504321 Targeting of heparanase-modified syndecan-1 by prosecretory mitogen lacritin requires conserved core GAGAL plus heparan and chondroitin sulfate as a novel hybrid binding site that enhances selectivity.
23482462 Lacritin stimulates tear protein secretion from lacrimal acinar cells stressed with inflammatory cytokines, however under the same conditions carbachol is completely ineffective. Inflammatory cytokines are elevated in dry eye, the most common eye disease. The implication is that topical lacritin might be an effective therapeutic for dry eye.
23425695 Tissue transglutaminase promotes crosslinking of lacritin between K82 or K85 and Q106 - the latter residing in the SDC1 binding domain of lacritin necessary for cell targeting, thus inactivating lacritin. Tissue transglutaminase is thought to be upregulated in dry eye, the most common eye disease.
23422824 Lacritin protein yields were improved primarily by hydrophobic or salt bridge mutagenesis and less so by elimination of rare codons.
23308132 Lacritin is 10-fold less in tears from individuals suffering from fungal keratitis, and is barely detectable in the initial stage of infection by Fusarium solani. Fungal keratitis accounts for half of all corneal ulcers in Africa and India.
More...

AA Sequence

MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQG      1 - 70
TAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA       71 - 138
//

Text Mined References (40)

PMID Year Title
26670139 2015 Lacritin Salvages Human Corneal Epithelial Cells from Lipopolysaccharide Induced Cell Death.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25530855 2014 Lacritin-mediated regeneration of the corneal epithelia by protein polymer nanoparticles.
25481446 2015 A thermo-responsive protein treatment for dry eyes.
25034600 2014 Topical administration of lacritin is a novel therapy for aqueous-deficient dry eye disease.
24942736 2014 A cleavage-potentiated fragment of tear lacritin is bactericidal.
23769845 2013 Lacritin and the tear proteome as natural replacement therapy for dry eye.
23748026 2013 Dracula's children: molecular evolution of vampire bat venom.
23640897 2013 Lacritin rescues stressed epithelia via rapid forkhead box O3 (FOXO3)-associated autophagy that restores metabolism.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
More...