Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.92
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.8e-05
osteosarcoma 7950 2.6e-05
Disease Target Count Z-score Confidence
Hirschsprung's disease 46 3.374 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.227 2.6e-05
psoriasis -1.900 1.8e-05

Gene RIF (3)

AA Sequence

MVRCLGPALLLLLLLGSASSVGGNRCVDAAEACTADARCQRLRSEYVAQCLGRAAQGGCPRARCRRALRR      1 - 70
FFARGPPALTHALLFCPCAGPACAERRRQTFVPSCAFSGPGPAPPSCLEPLNFCERSRVCRCARAAAGPW     71 - 140
RGWGRGLSPAHRPPAAQASPPGLSGLVHPSAQRPRRLPAGPGRPLPARLRGPRGVPAGTAVTPNYVDNVS    141 - 210
ARVAPWCDCGASGNRREDCEAFRGLFTRNRCLDGAIQAFASGWPPVLLDQLNPQGDPEHSLLQVSSTGRA    211 - 280
LERRSLLSILPVLALPALL                                                       281 - 299
//

Text Mined References (9)

PMID Year Title