Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.56
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Synonym

Gene

Gene RIF (2)

PMID Text
15225646 GDNF/GFRalpha1 is crucial for efficient signal transduction to recruit Ret protein into lipid rafts.
12624147 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVRCLGPALLLLLLLGSASSVGGNRCVDAAEACTADARCQRLRSEYVAQCLGRAAQGGCPRARCRRALRR      1 - 70
FFARGPPALTHALLFCPCAGPACAERRRQTFVPSCAFSGPGPAPPSCLEPLNFCERSRVCRCARAAAGPW     71 - 140
RGWGRGLSPAHRPPAAQASPPGLSGLVHPSAQRPRRLPAGPGRPLPARLRGPRGVPAGTAVTPNYVDNVS    141 - 210
ARVAPWCDCGASGNRREDCEAFRGLFTRNRCLDGAIQAFASGWPPVLLDQLNPQGDPEHSLLQVSSTGRA    211 - 280
LERRSLLSILPVLALPALL                                                       281 - 299
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15225646 2004 PSPN/GFRalpha4 has a significantly weaker capacity than GDNF/GFRalpha1 to recruit RET to rafts, but promotes neuronal survival and neurite outgrowth.
12624147 2003 Investigation of germline GFRA4 mutations and evaluation of the involvement of GFRA1, GFRA2, GFRA3, and GFRA4 sequence variants in Hirschsprung disease.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11551746 2001 hGFRalpha-4: a new member of the GDNF receptor family and a candidate for NBIA.
11116144 2001 Human glial cell line-derived neurotrophic factor receptor alpha 4 is the receptor for persephin and is predominantly expressed in normal and malignant thyroid medullary cells.
10958791 2000 Mammalian GFRalpha -4, a divergent member of the GFRalpha family of coreceptors for glial cell line-derived neurotrophic factor family ligands, is a receptor for the neurotrophic factor persephin.
9740802 1998 GFR alpha-4 and the tyrosine kinase Ret form a functional receptor complex for persephin.