Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.77
PubTator Score 4.29

Knowledge Summary

Patent (221)

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (10)

PMID Text
22774872 A two order of magnitude species difference is reported in potency of alpha-conotoxin RgIA for rat versus human alpha9alpha10 nAChR.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20584212 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20231857 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760673 CHRNA10 may have a role in "dizziness" in response to tobacco
19259974 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17559419 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17373692 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMD      1 - 70
ERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDG     71 - 140
AVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPAR    141 - 210
RRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTV    211 - 280
FQLLLAESMPPAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCV    281 - 350
RERGEPCGQSRPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK    351 - 420
RLARVMDRFFLAIFFSMALVMSLLVLVQAL                                            421 - 450
//

Text Mined References (15)

PMID Year Title
22774872 2012 Molecular basis for the differential sensitivity of rat and human ?9?10 nAChRs to ?-conotoxin RgIA.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20584212 2010 Multiple cholinergic nicotinic receptor genes affect nicotine dependence risk in African and European Americans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20231857 2011 Why do young women smoke? VI. A controlled study of nicotine effects on attention: pharmacogenetic interactions.
19760673 2010 Association of CHRN genes with "dizziness" to tobacco.
19259974 2009 Multiple distinct risk loci for nicotine dependence identified by dense coverage of the complete family of nicotinic receptor subunit (CHRN) genes.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18420419 2008 Muscle-like nicotinic receptor accessory molecules in sensory hair cells of the inner ear.
17559419 2008 Why do young women smoke? V. Role of direct and interactive effects of nicotinic cholinergic receptor gene variation on neurocognitive function.
More...