Property Summary

NCBI Gene PubMed Count 21
PubMed Score 179.62
PubTator Score 222.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-02
Atopic dermatitis 1.100 6.8e-04
atypical teratoid / rhabdoid tumor -1.700 1.5e-03
Breast cancer 2.400 2.7e-02
cystic fibrosis -1.100 1.8e-03
gastric cancer 1.300 1.6e-03
glioblastoma -1.500 6.8e-04
group 4 medulloblastoma -1.200 1.3e-02
hepatocellular carcinoma 1.600 2.0e-05
hereditary spastic paraplegia -1.388 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.6e-02
lung cancer 1.300 1.4e-02
malignant mesothelioma 2.500 1.1e-06
medulloblastoma, large-cell -2.600 3.8e-05
Multiple myeloma 1.391 5.3e-03
non-small cell lung cancer 1.441 4.2e-13
osteosarcoma 1.243 1.4e-02
ovarian cancer 1.700 3.3e-05
pancreatic cancer 1.100 1.0e-03
pancreatic carcinoma 1.100 1.0e-03
tuberculosis -1.700 5.2e-04

Synonym

Accession Q9GZZ1 D3DN74 Q68DQ1 hNaa50p
Symbols SAN
MAK3
NAT5
NAT13
NAT5P
NAT13P
hNaa50p

Gene

PANTHER Protein Class (2)

PDB

3TFY   2OB0   2PSW   4X5K  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (10)

AA Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK      1 - 70
RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK     71 - 140
RIEPADAHVLQKNLKVPSGQNADVQKTDN                                             141 - 169
//

Text Mined References (29)

PMID Year Title