Property Summary

NCBI Gene PubMed Count 17
Grant Count 13
R01 Count 2
Funding $2,015,632.83
PubMed Score 174.69
PubTator Score 222.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.300 0.002
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 1.100 0.001
Multiple myeloma 1.391 0.005
malignant mesothelioma 2.500 0.000
osteosarcoma 1.243 0.014
atypical teratoid / rhabdoid tumor -1.700 0.002
glioblastoma -1.500 0.001
medulloblastoma -1.600 0.000
medulloblastoma, large-cell -2.600 0.000
hereditary spastic paraplegia -1.388 0.012
Atopic dermatitis 1.100 0.001
tuberculosis and treatment for 6 months -2.200 0.000
non-small cell lung cancer 1.441 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.016
lung cancer 1.300 0.014
Breast cancer 2.400 0.027
cystic fibrosis -1.100 0.002
adult high grade glioma -1.100 0.013
pancreatic carcinoma 1.100 0.001
ovarian cancer 1.700 0.000

Gene RIF (8)

PMID Text
25886145 The study quantitatively compared the Nt-acetylomes of wild-type yeast S. cerevisiae expressing the endogenous yeast Naa50 (yNaa50), the congenic strain lacking yNaa50, and an otherwise identical strain expressing human Naa50 (hNaa50).
23557624 Development of the first N-terminal acetyltransferase (NAT) inhibitors, including a specific Naa50 inhibitor.
22311970 Human protein N-terminal acetyltransferase hNaa50p (hNAT5/hSAN) follows ordered sequential catalytic mechanism: combined kinetic and NMR study.
21900231 Naa50p can accommodate only an alpha-amino substrate and not a side chain lysine substrate that is acetylated by lysine acetyltransferase enzymes such as Gcn5.
19744929 Nat5 displays both protein N alpha- and N epsilon-acetyltransferase activity.
19398576 Data show that with MAK3 knockdown, p53 is stabilized and phosphorylated and there is a significant transcriptional activation of proapoptotic genes downstream of p53, and that localization of Arl8b is altered, suggesting that Arl8b is a Mak3 substrate.
17502424 May be specifically required for the maintenance of centromeric cohesion in mitosis.
16507339 The first description of the human homologue of Nat5p/San, hNAT5, the third component of the human NatA N-alpha-acetyltransferase complex

AA Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK      1 - 70
RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK     71 - 140
RIEPADAHVLQKNLKVPSGQNADVQKTDN                                             141 - 169
//

Text Mined References (25)

PMID Year Title
25886145 2015 N-terminal acetylome analysis reveals the specificity of Naa50 (Nat5) and suggests a kinetic competition between N-terminal acetyltransferases and methionine aminopeptidases.
25416956 2014 A proteome-scale map of the human interactome network.
23557624 2013 Design, synthesis, and kinetic characterization of protein N-terminal acetyltransferase inhibitors.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22311970 2012 Human protein N-terminal acetyltransferase hNaa50p (hNAT5/hSAN) follows ordered sequential catalytic mechanism: combined kinetic and NMR study.
21900231 2011 Structure of a ternary Naa50p (NAT5/SAN) N-terminal acetyltransferase complex reveals the molecular basis for substrate-specific acetylation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...