Property Summary

NCBI Gene PubMed Count 21
PubMed Score 163.75
PubTator Score 22.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.200 0.000

Synonym

Accession Q9GZY8 Q567U1 Q658R6 Q9BVZ1 Q9H690 Q9NRG8
Symbols EMPF2
GL004
C2orf33

Gene

MFF

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (10)

PMID Text
26578513 membrane-anchored Mff differentially regulates various Drp1 isoforms.
26008206 loss of Mff results in failure of Parkin translocation and final clearance of damaged mitochondria
25912308 Data show that expression of MFF protein, miR-593-5p and BRCA1 protein correlates with cisplatin sensitivity and survival of tongue squamous cell carcinoma (TSCC).
25431021 Mitochondrial fission factor (MFF) mRNA is a direct target of miR-27, whose ectopic expression decreases MFF expression through binding to its 3'-untranslated region.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23284813 TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
22878233 MFF over-expression results in extensive mitochondrial fragmentation, driving mitochondrial dysfunction. MFF fibroblasts undergo oxidative stress, with increased ROS production, and the onset of autophagy and mitophagy.
22595523 PEX11 proteins attract both Mff and human Fis1 (hFis1) to their site of action.
21509594 MFF gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
18353969 Mff is a novel component of a conserved membrane fission pathway used for constitutive and induced fission of mitochondria and peroxisomes.

AA Sequence

MSKGTSSDTSLGRVSRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGV      1 - 70
PNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQ     71 - 140
NEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWHRSDSAPRNKISRFQAPISAPEYTVTPSPQQARVCP    141 - 210
PHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTT    211 - 280
IEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR            281 - 342
//

Text Mined References (36)

PMID Year Title
26578513 2016 Distinct Splice Variants of Dynamin-related Protein 1 Differentially Utilize Mitochondrial Fission Factor as an Effector of Cooperative GTPase Activity.
26008206 2015 Parkin-induced ubiquitination of Mff promotes its association with p62/SQSTM1 during mitochondrial depolarization.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25912308 2015 Mitochondrial fission determines cisplatin sensitivity in tongue squamous cell carcinoma through the BRCA1-miR-593-5p-MFF axis.
25431021 2014 miR-27 regulates mitochondrial networks by directly targeting the mitochondrial fission factor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
23284813 2012 TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
23283981 2013 Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission.
More...