Property Summary

NCBI Gene PubMed Count 34
PubMed Score 108.08
PubTator Score 57.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.100 1.5e-03
astrocytoma 1.300 4.1e-02
Astrocytoma, Pilocytic 1.500 9.4e-09
Chronic Lymphocytic Leukemia -1.659 4.7e-07
cutaneous lupus erythematosus 1.100 2.0e-02
glioblastoma 1.600 2.3e-03
group 3 medulloblastoma -1.100 1.9e-03
interstitial cystitis 1.500 3.6e-03
invasive ductal carcinoma 1.263 3.5e-04
non-small cell lung cancer -1.382 3.2e-13
osteosarcoma 1.472 2.4e-08
primary Sjogren syndrome 1.300 3.9e-04
subependymal giant cell astrocytoma 1.228 1.5e-02
ulcerative colitis 1.700 7.3e-04

Gene RIF (19)

AA Sequence

MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA      1 - 70
DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL     71 - 140
ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG    141 - 210
QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA                                         211 - 243
//

Text Mined References (37)

PMID Year Title