Property Summary

NCBI Gene PubMed Count 33
Grant Count 96
R01 Count 26
Funding $14,563,319.43
PubMed Score 105.03
PubTator Score 57.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9GZY6 A6NFK6 A8K209 A8K4F1 D3DXF9 Q9BXX8 Q9NZY9
Symbols LAB
NTAL
WSCR5
WBSCR5
HSPC046
WBSCR15

Gene

PDB

3MAZ  

 GO Function (1)

Gene RIF (18)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of LAT2 in human monocyte-derived dendritic cells
25299125 The detergent-induced stabilization of the purified human 4F2hc-LAT2 complex presented here paves the way towards its crystallization and structure determination at high-resolution
24456692 The AML1/ETO target gene LAT2 interferes with differentiation of normal hematopoietic precursor cells.
23001822 LAT2 is an early mediator of the anti-leukemic activity of alkylphospholipids and arsenic trioxide. Thus, LAT2 may be used as a target for the design of drugs for cancer therapy.
22269118 NTAL acts as a tumor suppressor that enhances the proximal signaling of leukemic blasts. The key downstream molecule responsible for the biological effect of TCR signaling is ERK.
20643813 LAB has the ability to modulate signaling in virtually every type of leukocyte.
19879355 LAT2 protein (NTAL) participates in the activation of the c-Met-Grb2-ERK-cPLA2 signalling cascade at early stages of H. pylori infection.
19808856 LAT2 genes may play important roles in leiomyoma cell proliferation and regulate leiomyoma growth.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19183565 expression separates T lineage leukemias into two subgroups with good and poor prognostic outcome to prednisone therapy in acute lymphoblastic leukemia in children
More...

AA Sequence

MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA      1 - 70
DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL     71 - 140
ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG    141 - 210
QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA                                         211 - 243
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25299125 2014 Detergent-induced stabilization and improved 3D map of the human heteromeric amino acid transporter 4F2hc-LAT2.
24456692 2014 The AML1/ETO target gene LAT2 interferes with differentiation of normal hematopoietic precursor cells.
23001822 2012 Linker for activation of T-cell family member2 (LAT2) a lipid raft adaptor protein for AKT signaling, is an early mediator of alkylphospholipid anti-leukemic activity.
22269118 2012 The adaptor protein NTAL enhances proximal signaling and potentiates corticosteroid-induced apoptosis in T-ALL.
20643813 2011 LAB/NTAL/Lat2: a force to be reckoned with in all leukocytes?
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20442417 2010 Loops govern SH2 domain specificity by controlling access to binding pockets.
19879355 2010 Non-T cell activation linker regulates ERK activation in Helicobacter pylori-infected epithelial cells.
19808856 2009 Progesterone and mifepristone regulate L-type amino acid transporter 2 and 4F2 heavy chain expression in uterine leiomyoma cells.
More...