Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
R01 Count 6
Funding $281,786.01
PubMed Score 0.00
PubTator Score 3.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.512 0.000
malignant mesothelioma 1.400 0.000
osteosarcoma 1.960 0.000
lung cancer -1.700 0.000
acute myeloid leukemia -2.000 0.027

Gene RIF (3)

PMID Text
26655997 Restoration of miR-127-3p and miR-376a-3p counteracts the neoplastic phenotype of giant cell tumor of bone derived stromal cells by targeting COA1, GLE1 and PDIA6.
22356826 Encodes a mitochondrial protein
22356826 Human ortholog of fungal COA1 (Cytochrome Oxidase Assembly 1)

AA Sequence

MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNI      1 - 70
HYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENG     71 - 140
DEVKKE                                                                    141 - 146
//

Text Mined References (11)

PMID Year Title
26655997 2016 Restoration of miR-127-3p and miR-376a-3p counteracts the neoplastic phenotype of giant cell tumor of bone derived stromal cells by targeting COA1, GLE1 and PDIA6.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...