Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 3.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.4e-07
malignant mesothelioma 3232 1.6e-06
Multiple myeloma 1332 2.1e-04
lung cancer 4740 1.2e-02
acute myeloid leukemia 783 2.7e-02

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -2.000 2.7e-02
lung cancer -1.400 1.2e-02
malignant mesothelioma 1.400 1.6e-06
Multiple myeloma 1.512 2.1e-04
osteosarcoma 1.960 8.4e-07

Gene RIF (3)

AA Sequence

MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNI      1 - 70
HYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENG     71 - 140
DEVKKE                                                                    141 - 146
//

Text Mined References (11)

PMID Year Title