Property Summary

NCBI Gene PubMed Count 18
PubMed Score 291.95
PubTator Score 68.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.118 1.7e-02
active ulcerative colitis 1.175 1.5e-02
Astrocytoma, Pilocytic 1.300 1.5e-05
atypical teratoid / rhabdoid tumor 1.900 1.5e-05
Breast cancer 2.800 2.8e-02
ependymoma 1.500 6.1e-14
glioblastoma 1.300 4.3e-02
malignant mesothelioma -2.400 1.7e-08
nasopharyngeal carcinoma 1.300 5.2e-03
osteosarcoma 1.501 2.3e-03
ovarian cancer -1.500 7.7e-04
primary pancreatic ductal adenocarcinoma 1.321 3.0e-02
progressive supranuclear palsy -1.100 1.2e-02

Gene RIF (5)

AA Sequence

MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDEC      1 - 70
CDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETV     71 - 140
NQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECID    141 - 210
YGSKTVKCMNCMF                                                             211 - 223
//

Text Mined References (20)

PMID Year Title