Property Summary

NCBI Gene PubMed Count 18
Grant Count 117
R01 Count 75
Funding $21,532,566.06
PubMed Score 265.83
PubTator Score 68.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q9GZX9 B2RE08 D3DUH9 Q8NBI7 Q96K46
Symbols TSG

Gene

Gene RIF (5)

PMID Text
26517884 Data suggest CHRD (chordin) cleavage by tolloid-like metalloproteinases is insufficient to regulate BMP(bone morphogenetic protein)/BMPR signaling; CHRD fragments and TSG (twisted gastrulation protein) contribute to inhibition of BMP/BMPR signaling.
23641068 these results suggest that BMPER and Tsg maintain a fine-tuned equilibrium that controls BMP pathway activity and is necessary for vascular cell homeostasis.
21227728 mutations in the twisted gastrulation homolog 1 gene are neither a common direct cause nor a frequent modifying factor for human holoprosencephaly pathologies
19414861 interferes with BMP-mediated hepcidin expression and may act with GDF15 to dysregulate iron homeostasis in thalassemia syndromes.
17164348 Tsg functions as an agonist synergizing with TGF-beta to inhibit T-cell activation.

AA Sequence

MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDEC      1 - 70
CDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETV     71 - 140
NQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECID    141 - 210
YGSKTVKCMNCMF                                                             211 - 223
//

Text Mined References (20)

PMID Year Title
26517884 2015 The role of chordin fragments generated by partial tolloid cleavage in regulating BMP activity.
25416956 2014 A proteome-scale map of the human interactome network.
23641068 2013 Antagonism and synergy between extracellular BMP modulators Tsg and BMPER balance blood vessel formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
21227728 2011 Minimal evidence for a direct involvement of twisted gastrulation homolog 1 (TWSG1) gene in human holoprosencephaly.
19414861 2009 Identification of TWSG1 as a second novel erythroid regulator of hepcidin expression in murine and human cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17164348 2007 Twisted gastrulation (Tsg) is regulated by Tob and enhances TGF-beta signaling in activated T lymphocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...