Property Summary

NCBI Gene PubMed Count 221
PubMed Score 635.26
PubTator Score 6539.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer -1.600 8.3e-04
primary Sjogren syndrome 1.100 2.5e-03
psoriasis -1.100 5.6e-10

 GO Component (2)

Gene RIF (205)

AA Sequence

MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDL      1 - 70
DPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMT     71 - 140
FKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL                141 - 198
//

Text Mined References (223)

PMID Year Title