Property Summary

NCBI Gene PubMed Count 208
Grant Count 250
R01 Count 141
Funding $37,745,287.09
PubMed Score 602.15
PubTator Score 6539.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
primary Sjogren syndrome 1.100 0.003
ovarian cancer -1.600 0.001
psoriasis -1.100 0.000

Synonym

Accession Q9GZX7 Q6QJ81 Q8NFC1
Symbols AID
ARP2
CDA2
HIGM2
HEL-S-284

Gene

PANTHER Protein Class (2)

PDB

5JJ4  

 GO Component (2)

Gene RIF (195)

PMID Text
26867650 Data suggest novel mechanism in innate immunity allows cytokine TGF-beta to restrict viral circular DNA in hepatocyte nuclei via innate immunity; AID deaminates circular DNA of hepatitis B virus leading to DNA degradation; mechanism depends on UNG.
26638776 Mutations in activation-induced cytidine deaminase is associated with indolent chronic lymphocytic leukaemia.
26545377 AID mutations leading to AID deficiency are the most frequent underlying molecular basis of hyper IgM syndrome in consanguineous Tunisian patients.
26537386 Studies indicate that gene conversion mediated by activation-induced cytidine deaminase (AID) has been found to contribute to generation of the primary antibody repertoire.
26398702 AICDA/APOBEC family of cytidine deaminases is significant in innate immunity, as it restricts numerous viruses, including HBV, through hypermutationdependent and independent mechanisms. (Review)
26365193 DNA methylation dynamics of germinal center B cells are mediated by AID.
26355458 identify AID derivatives that accelerate somatic hypermutation with minimal impact on viability, which will be useful tools for engineering genes and proteins by iterative mutagenesis and selection
26223652 Data show that microRNAs miR-155 and miR-16 downregulate activation-induced cytidine deaminase (AID) and transcription factor E47 in B Cells through binding of the 3'-untranslated regions.
26219420 aberrant expression of AID may reflect continuous B cell activation and sustained survival signals in HCV-related CV patients.
26166388 The high levels of memory and activated B cells and follicular helper T cells were positively associated with the progression of immunoglobulin A nephropathy. This may be mediated by the overexpression of AID, which is potentially regulated by IL21.
More...

AA Sequence

MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDL      1 - 70
DPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMT     71 - 140
FKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL                141 - 198
//

Text Mined References (209)

PMID Year Title
26867650 2016 TGF-? triggers HBV cccDNA degradation through AID-dependent deamination.
26638776 2015 Whole-genome sequencing reveals activation-induced cytidine deaminase signatures during indolent chronic lymphocytic leukaemia evolution.
26545377 2016 Novel and recurrent AID mutations underlie prevalent autosomal recessive form of HIGM in consanguineous patients.
26537386 2015 Diversification of the Primary Antibody Repertoire by AID-Mediated Gene Conversion.
26398702 2015 Associations between activation-induced cytidine deaminase/apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like cytidine deaminase expression, hepatitis B virus (HBV) replication and HBV-associated liver disease (Review).
26365193 2015 DNA Methylation Dynamics of Germinal Center B Cells Are Mediated by AID.
26355458 2015 Cell Cycle Regulates Nuclear Stability of AID and Determines the Cellular Response to AID.
26223652 2015 MicroRNAs miR-155 and miR-16 Decrease AID and E47 in B Cells from Elderly Individuals.
26219420 2015 Activation-induced cytidine deaminase in B cells of hepatits C virus-related cryoglobulinaemic vasculitis.
26166388 2015 Increased frequencies of memory and activated B cells and follicular helper T cells are positively associated with high levels of activation?induced cytidine deaminase in patients with immunoglobulin A nephropathy.
More...