Property Summary

NCBI Gene PubMed Count 267
PubMed Score 341.00
PubTator Score 492.26

Knowledge Summary

Patent

No data available

Synonym

Accession Q9GZX6 IL-22
Symbols TIFa
IL-21
IL-22
ILTIF
IL-TIF
IL-D110
zcyto18
TIFIL-23

Gene

PDB

3G9V   1M4R   1YKB   3DGC   3DLQ   3Q1S  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (252)

AA Sequence

MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT      1 - 70
DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH     71 - 140
IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI                                   141 - 179
//

Text Mined References (268)

PMID Year Title