Property Summary

NCBI Gene PubMed Count 267
PubMed Score 341.00
PubTator Score 492.26

Knowledge Summary

Patent

No data available

Gene RIF (252)

AA Sequence

MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT      1 - 70
DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH     71 - 140
IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI                                   141 - 179
//

Text Mined References (268)

PMID Year Title