Property Summary

NCBI Gene PubMed Count 41
Grant Count 12
R01 Count 9
Funding $587,248.5
PubMed Score 17.09
PubTator Score 24.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.190 0.005
tuberculosis and treatment for 6 months 1.300 0.000
acute myeloid leukemia 1.700 0.004
ovarian cancer -1.100 0.000

Gene RIF (35)

PMID Text
26658611 villin directly interacts with a transcriptional corepressor and ligand of the Slug promoter, ZBRK1.
25749518 ZBRK1 suppresses renal cancer progression perhaps by regulating VHL expression through formation of a complex with VHL and p300 in renal cancer
25107531 MAGE proteins bind to KAP1, a gene repressor and ubiquitin E3 ligase which also binds KRAB domain containing zinc finger transcription factors (KZNFs), and MAGE expression may affect KZNF mediated gene regulation.
24924633 The secondary structure of the ZBRK1-DNA complex is found to be significantly altered from the standard B-DNA conformation.
23991171 results indicate that a loss of ZBRK1 contributes to the increased expression of KAP1, potentiating its role to enhance metastasis and invasion
23151675 promoter assays in two breast cancer cell lines identified two haplotypes (H11 and H12) stimulating significantly the expression of ZNF350 transcript compared with the common haplotype H8
22975076 ZBRK1 negatively regulates the HIV-1 LTR
21791101 high levels of gene activity in the genomic environment and the pre-deposition of repressive histone marks within a gene increase its susceptibility to KRAB/KAP1-mediated repression
20926453 KRAB-containing zinc-finger transcriptional regulator, ZBRK1, an interaction partner of the SCA2 gene product ataxin-2.
20713352 RB.E2F1 complex plays a critical role in ZBRK1 transcriptional repression, and loss of this repression may contribute to cellular sensitivity of DNA damage, ultimately leading to carcinogenesis.
More...

AA Sequence

MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIE      1 - 70
DGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNL     71 - 140
TLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSE    141 - 210
CGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIH    211 - 280
QKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSE    281 - 350
CGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH    351 - 420
KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQP    421 - 490
VVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP                                491 - 532
//

Text Mined References (44)

PMID Year Title
26658611 2016 By moonlighting in the nucleus, villin regulates epithelial plasticity.
25749518 2015 ZBRK1, a novel tumor suppressor, activates VHL gene transcription through formation of a complex with VHL and p300 in renal cancer.
25107531 2014 MAGE proteins regulate KRAB zinc finger transcription factors and KAP1 E3 ligase activity.
24924633 2014 Tetrameric ZBRK1 DNA binding domain has affinity towards cognate DNA in absence of zinc ions.
23991171 2013 Loss of ZBRK1 contributes to the increase of KAP1 and promotes KAP1-mediated metastasis and invasion in cervical cancer.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
23151675 2013 Analysis of ZNF350/ZBRK1 promoter variants and breast cancer susceptibility in non-BRCA1/2 French Canadian breast cancer families.
22975076 2012 ZBRK1 represses HIV-1 LTR-mediated transcription.
21791101 2011 A gene-rich, transcriptionally active environment and the pre-deposition of repressive marks are predictive of susceptibility to KRAB/KAP1-mediated silencing.
20926453 2011 The KRAB-containing zinc-finger transcriptional regulator ZBRK1 activates SCA2 gene transcription through direct interaction with its gene product, ataxin-2.
More...