Property Summary

NCBI Gene PubMed Count 42
PubMed Score 17.93
PubTator Score 24.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis and treatment for 6 months 409 9.2e-05
ovarian cancer 8520 4.9e-04
osteosarcoma 7950 4.7e-03
acute myeloid leukemia 783 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Breast cancer 3578 3.28 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.500 5.0e-02
osteosarcoma -1.190 4.7e-03
ovarian cancer -1.100 4.9e-04
tuberculosis and treatment for 6 months 1.300 9.2e-05

Gene RIF (36)

AA Sequence

MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIE      1 - 70
DGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNL     71 - 140
TLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSE    141 - 210
CGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIH    211 - 280
QKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSE    281 - 350
CGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH    351 - 420
KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQP    421 - 490
VVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP                                491 - 532
//

Text Mined References (45)

PMID Year Title