Property Summary

NCBI Gene PubMed Count 45
PubMed Score 39.52
PubTator Score 70.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 3.4e-05
ependymoma 1.800 3.7e-06
group 3 medulloblastoma -1.600 5.5e-03
medulloblastoma, large-cell -1.200 5.8e-03
nasopharyngeal carcinoma -1.500 3.2e-10
osteosarcoma 2.248 6.7e-03

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (35)

AA Sequence

MWLPRVSSTAVTALLLAQTFLLLFLVSRPGPSSPAGGEARVHVLVLSSWRSGSSFVGQLFNQHPDVFYLM      1 - 70
EPAWHVWTTLSQGSAATLHMAVRDLVRSVFLCDMDVFDAYLPWRRNLSDLFQWAVSRALCSPPACSAFPR     71 - 140
GAISSEAVCKPLCARQSFTLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRS    141 - 210
REQTAKALARDNGIVLGTNGTWVEADPGLRVVREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAREP    211 - 280
LAEIRALYAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHALPFAKIRRVQELCA    281 - 350
GALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN                             351 - 395
//

Text Mined References (46)

PMID Year Title