Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.85
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9GZW8 A6NP53 Q6IAG8
Symbols CFFM4
MS4A8
4SPAN2
CD20L4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAP      1 - 70
YPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMV     71 - 140
ALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQL    141 - 210
YSNNPGSSFSSTQSQDHIQQVKKSSSRSWI                                            211 - 240
//

Text Mined References (11)

PMID Year Title