Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.7e-13
malignant mesothelioma 3232 1.7e-05
psoriasis 6694 5.9e-05
medulloblastoma, large-cell 6241 6.1e-03
lung cancer 4740 3.2e-02

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.100 3.2e-02
malignant mesothelioma 1.100 1.7e-05
medulloblastoma, large-cell -1.200 6.1e-03
osteosarcoma -3.294 2.7e-13
psoriasis -3.400 5.9e-05

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREALLQLQKLC      1 - 70
CQWLRPEKCTKEQILELLVLEQFPTVLLQEIQIWVRQQHPESGEEAVALVEDLQKEPGRQRLEPRARPSG     71 - 140
RTPPAQLRSPWPMTAAGPASRARASETGSTASCAGRWRTCCAAAAAPSAARSASARTGRSTSSCARAARA    141 - 210
PSATEGALTRTPAPRRPLQRRRPGTGPWRPGRQRGAGTAPPGTQPRQRPSPRPTPRRPRPRLARPRAGQK    211 - 280
PWLLVIRSMERVMYVMLIIQMETEDV                                                281 - 306
//

Text Mined References (8)

PMID Year Title