Property Summary

NCBI Gene PubMed Count 405
PubMed Score 1726.39
PubTator Score 1313.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Gene RIF (388)

AA Sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY      1 - 70
SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR     71 - 140
AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL    141 - 210
PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI                                 211 - 251
//

Text Mined References (411)

PMID Year Title