Property Summary

NCBI Gene PubMed Count 350
Grant Count 386
R01 Count 198
Funding $45,934,328
PubMed Score 1538.82
PubTator Score 1313.79

Knowledge Summary

Patent

No data available

Synonym

Accession Q9GZV9 Q4V758 FGF-23
Symbols ADHR
FGFN
HYPF
HPDR2
PHPTC

Gene

PANTHER Protein Class (2)

PDB

2P39  

Gene RIF (333)

PMID Text
27403909 fibroblast growth factor 23 plays a pivotal role in calcium-phosphorus metabolism in patients with chronic kidney disease (review)
27085781 Data suggest that intraperitoneal injection of recombinant Fgf23 extends time to exhaustion of mice on treadmill and reduces exercise-induced production of reactive oxygen species in skeletal muscle.
26986127 High FGF23 levels were observed to be associated with low hemoglobin levels, which may be partially mediated through the effects of serum aldosterone levels in chronic kidney disease stages 3 and 4.
26956379 Suggest immunohistochemistry for FGF23 is an useful diagnostic adjunct for phosphaturic mesenchymal tumors.
26956260 These cross-sectional community-based data from a diverse urban sample show an association between elevated FGF23 and small vessel disease and magnetic resonance imaging-defined brain infarction in men, independent of chronic kidney disease.
26878171 FGF23 acts directly on PMNs and dampens host defense by direct interference with chemokine signaling and integrin activation.
26813507 Its overproduction causes hereditary hypophosphatemic rickets due to abnormal phosphorus reabsorption of proximal kidney tubules. (review)
26813503 Excessive actions of fibroblast growth factor 23(FGF23)result in several kinds of hypophosphatemic rickets and osteomalacia.(review)
26813502 It is a humoral factor that reduces serum phosphate.
26797283 Based on the collective findings, we suggest that vIRF2 acts as an activator in PI3K/Akt pathway.
More...

AA Sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY      1 - 70
SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR     71 - 140
AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL    141 - 210
PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI                                 211 - 251
//

Text Mined References (356)

PMID Year Title
27403909 2016 [Fibroblast growth factor 23 in chronic kidney disease in children].
27085781 2016 Exercise-stimulated FGF23 promotes exercise performance via controlling the excess reactive oxygen species production and enhancing mitochondrial function in skeletal muscle.
26986127 2016 High Fibroblast Growth Factor 23 Levels Associated With Low Hemoglobin Levels in Patients With Chronic Kidney Disease Stages 3 and 4.
26956379 2016 Immunohistochemical and molecular detection of the expression of FGF23 in phosphaturic mesenchymal tumors including the non-phosphaturic variant.
26956260 2016 Fibroblast Growth Factor 23 Is Associated With Subclinical Cerebrovascular Damage: The Northern Manhattan Study.
26878171 2016 FGF23 signaling impairs neutrophil recruitment and host defense during CKD.
26813507 2016 [FGF23 related hypophosphatemic rickets:current therapy and unresolved issues].
26813503 2016 [Inhitibion of FGF23 activities as a possible new treatment for patients with FGF23-related hypophosphatemic diseases].
26813502 2016 [Epidemiology of FGF23-related hypophosophatemic diseases].
26797283 2016 Fibroblast growth factor-23 induces cellular senescence in human mesenchymal stem cells from skeletal muscle.
More...