Property Summary

NCBI Gene PubMed Count 29
Grant Count 60
R01 Count 12
Funding $13,441,081.43
PubMed Score 929.69
PubTator Score 95.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical adenoma -1.045 0.016
adrenocortical carcinoma -1.142 0.000
interstitial cystitis -3.000 0.000
ovarian cancer 1.100 0.000
psoriasis -1.300 0.000

Synonym

Accession Q9GZV3 Q53TF2
Symbols CHT
CHT1
CMS20
HMN7A

Gene

PANTHER Protein Class (2)

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
488975 screening 2634 / 0 / 303961 Primary cell-based screen for identification of compounds that inhibit the Choline Transporter (CHT)
488977 screening 1511 / 0 / 305084 Primary cell-based screen for identification of compounds that allosterically activate the Choline Transporter (CHT)
488996 summary 0 / 0 / 0 Summary of probe development for activators of the Choline Transporter (CHT)
488997 summary 0 / 0 / 0 Summary of probe development for inhibitors of the Choline Transporter (CHT)
493221 screening 1714 / 0 / 723 Confirmatory screen for compounds that inhibit the Choline Transporter (CHT)
493222 screening 94 / 0 / 2343 Counter screen assay of the parental HEK293 cells for compounds that inhibit the Choline Transporter (CHT)
504833 screening 2234 / 0 / 222 Confirmatory screen for compounds that activate the Choline Transporter (CHT)
504840 confirmatory 891 / 5 / 648 Dose responses of compounds that inhibit the Choline Transporter (CHT) - 5 point CRC
588401 confirmatory 274 / 1 / 118 Dose responses of compounds that inhibit the Choline Transporter (CHT) - 10 point CRC
602208 confirmatory 14 / 0 / 7 JHICC_CHT_Inh_3H uptake_CRC
More...

Gene RIF (19)

PMID Text
26161852 These data show that acute exposure of depolarized cells to insulin is coupled to transiently increased levels of CHT proteins at the cell surface, and that this is attenuated by chronic insulin exposure.
24666128 This study demonstrated a specific impairment in cognitive control associated with the Ile89Val polymorphism of SLC5A7.
23392663 In transgenic animals with a heterozygous deletion of the choline transporter there is impairment in performing sustained attention tasks.
23141292 Our findings compel consideration of mutations in SLC5A7 or its functional partners in relation to unexplained motor neuronopathies.
23132865 CHT1 forms a homo-oligomer on the cell surface in cultured cells.
22483273 [review] The critical role of CHT in maintaining cholinergic transmission indicates that it could be a target for therapeutic intervention to promote acetylcholine synthesis, the accomplishment of which has not been adequately addressed.
22483271 This mini-review discusses structural requirements for both organic cationic transporters OCT1 and OCT2 versus the blood-brain barrier choline transporter (BBBCHT) are discussed and compared.
22361880 Nedd4-2 mediated ubiquitination regulates the cell surface expression of CHT1 in HEK293 cells.
21337021 Polymorphic variation in the CHT1 gene can predict early, subclinical measures of carotid atherosclerosis.
21163949 overexpressed ChAT enhanced transcription of the CHT1 gene but not the VACHT gene
More...

AA Sequence

MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYING      1 - 70
TAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMF     71 - 140
WAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHP    141 - 210
AVADIGFTAVHAKYQKPWLGTVDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFG    211 - 280
CLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADS    281 - 350
SILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ    351 - 420
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLT    421 - 490
NICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNK    491 - 560
EAFLDVDSSPEGSGTEDNLQ                                                      561 - 580
//

Text Mined References (29)

PMID Year Title
26161852 2015 Insulin Regulates the Activity of the High-Affinity Choline Transporter CHT.
24666128 2014 Disposed to distraction: genetic variation in the cholinergic system influences distractibility but not time-on-task effects.
23392663 2013 The presynaptic choline transporter imposes limits on sustained cortical acetylcholine release and attention.
23141292 2012 Defective presynaptic choline transport underlies hereditary motor neuropathy.
23132865 2012 Transmembrane topology and oligomeric structure of the high-affinity choline transporter.
22483273 2012 Choline transporter CHT regulation and function in cholinergic neurons.
22483271 2012 The blood-brain barrier choline transporter.
22361880 2012 The high-affinity choline transporter CHT1 is regulated by the ubiquitin ligase Nedd4-2.
21337021 2012 Polymorphic variation in choline transporter gene (CHT1) is associated with early, subclinical measures of carotid atherosclerosis in humans.
21163949 2011 Nuclear choline acetyltransferase activates transcription of a high-affinity choline transporter.
More...