Property Summary

Ligand Count 6
NCBI Gene PubMed Count 31
PubMed Score 986.49
PubTator Score 95.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical adenoma -1.045 1.6e-02
adrenocortical carcinoma -1.142 1.1e-04
interstitial cystitis -2.900 2.5e-04
ovarian cancer 1.100 3.7e-08
psoriasis -1.300 2.3e-09

Protein-protein Interaction (1)

Gene RIF (21)

AA Sequence

MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYING      1 - 70
TAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMF     71 - 140
WAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHP    141 - 210
AVADIGFTAVHAKYQKPWLGTVDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFG    211 - 280
CLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADS    281 - 350
SILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ    351 - 420
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLT    421 - 490
NICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNK    491 - 560
EAFLDVDSSPEGSGTEDNLQ                                                      561 - 580
//

Text Mined References (31)

PMID Year Title