Property Summary

NCBI Gene PubMed Count 29
Grant Count 5
R01 Count 5
Funding $899,112.5
PubMed Score 35.21
PubTator Score 18.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
25585647 The Ankrd2 was found to be expressed in both the cytoplasm and nucleus, independently from maturation status of cardiomyocytes.
25125175 Report structure activity relationships for ANKRD2.
24647531 Interaction is demonstrated between ZASP and two new binding partners both of which have roles in signalling, regulation of gene expression and muscle differentiation; the mechanosensing protein Ankrd2 and the tumour suppressor protein p53.
24434510 Ankrd2 as a potent repressor of inflammatory responses through direct interaction with the NF-kappaB repressor subunit p50.
22185618 Although analyzed in a limited number of patients, there is a considerable body of evidence that MARP proteins could be suitable candidates for prognostic and diagnostic biomarkers.
22016770 Ankrd2 is a potent regulator in muscle cells affecting a multitude of pathways and processes
21737686 Ankrd2 is a novel Akt2 specific substrate and regulates myogenic differentiation
17206105 ARPP was localized in mitochondria and nuclei in both the normal distal renal tubule and oncocytoma but not in chromophobe renal cell carcinomas.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16021567 Arpp is a novel skeletal muscle-specific marker, which is useful for differential diagnosis of rhabdomyosarcoma
More...

AA Sequence

MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL      1 - 70
LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP     71 - 140
EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ    141 - 210
DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG    211 - 280
DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG    281 - 350
RETPQPVPAQ                                                                351 - 360
//

Text Mined References (29)

PMID Year Title
27393496 2016 Differential expression and localization of Ankrd2 isoforms in human skeletal and cardiac muscles.
25585647 2015 Profiling of skeletal muscle Ankrd2 protein in human cardiac tissue and neonatal rat cardiomyocytes.
25125175 2014 Probing muscle ankyrin-repeat protein (MARP) structure and function.
24647531 2014 ZASP interacts with the mechanosensing protein Ankrd2 and p53 in the signalling network of striated muscle.
24434510 2014 Ankrd2 is a modulator of NF-?B-mediated inflammatory responses during muscle differentiation.
23811403 2013 Ankrd1 is a transcriptional repressor for the androgen receptor that is downregulated by testosterone.
22185618 Muscle ankyrin repeat proteins: their role in striated muscle function in health and disease.
22016770 2011 Multi-tasking role of the mechanosensing protein Ankrd2 in the signaling network of striated muscle.
21737686 2011 Ankrd2/ARPP is a novel Akt2 specific substrate and regulates myogenic differentiation upon cellular exposure to H(2)O(2).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...