Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.45
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.3e-07
malignant mesothelioma 3232 3.9e-06
osteosarcoma 7950 1.1e-04
Disease Target Count Z-score Confidence
Tropical spastic paraparesis 15 3.165 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 3.9e-06
osteosarcoma -1.139 1.1e-04
ovarian cancer -1.100 2.3e-07

Synonym

Accession Q9GZU8
Symbols CDA10
NIP30
CDA018
C16orf94

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE      1 - 70
EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP     71 - 140
IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG    141 - 210
ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP                              211 - 254
//

Text Mined References (19)

PMID Year Title