Property Summary

NCBI Gene PubMed Count 24
PubMed Score 27.82
PubTator Score 19.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 3.7e-07
glioblastoma 5792 2.8e-05
pediatric high grade glioma 1064 2.9e-05
psoriasis 6694 1.0e-04
osteosarcoma 7950 2.4e-03

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 3.7e-07
glioblastoma 1.300 2.8e-05
osteosarcoma -1.539 2.4e-03
pediatric high grade glioma 1.100 2.9e-05
psoriasis -1.600 1.0e-04

Protein-protein Interaction (10)

Gene RIF (13)

AA Sequence

MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAI      1 - 70
PKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQ     71 - 140
RMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPA    141 - 210
SYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS                       211 - 261
//

Text Mined References (28)

PMID Year Title