Property Summary

Ligand Count 212
NCBI Gene PubMed Count 132
PubMed Score 306.66
PubTator Score 210.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.253 2.2e-03
adult high grade glioma -1.100 1.5e-03
atypical teratoid / rhabdoid tumor 1.300 1.3e-04
fascioscapulohumeral muscular dystrophy 1.088 2.4e-04
glioblastoma 1.200 2.8e-04
lung cancer 1.600 3.2e-05
medulloblastoma, large-cell 1.300 5.3e-04
non-small cell lung cancer 1.058 4.2e-12
osteosarcoma 1.084 6.4e-03
ovarian cancer -1.800 1.6e-04
pancreatic ductal adenocarcinoma liver m... -1.818 2.3e-02

Protein-protein Interaction (1)

PDB (32)

Gene RIF (109)

AA Sequence

MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVG      1 - 70
PHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAA     71 - 140
EAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVV    141 - 210
DDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLI    211 - 280
RHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGK    281 - 350
AQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS    351 - 420
VGKDVF                                                                    421 - 426
//

Text Mined References (143)

PMID Year Title