Property Summary

NCBI Gene PubMed Count 120
Grant Count 125
R01 Count 86
Funding $9,776,942.49
PubMed Score 287.48
PubTator Score 210.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9GZT9 Q8N3M8 Q9BZS8 Q9BZT0
Symbols HPH2
PHD2
SM20
ECYT3
HALAH
HPH-2
HIFPH2
ZMYND6
C1orf12
HIF-PH2

Gene

PDB

2G19   2G1M   2HBT   2HBU   2Y33   2Y34   3HQR   3HQU   3OUH   3OUI   3OUJ   4BQW   4BQX   4BQY   4JZR   4KBZ   4UWD   5A3U   5L9B   5L9R   5L9V   5LA9   5LAS   5LAT   5LB6   5LBB   5LBC   5LBE   5LBF  

Gene RIF (97)

PMID Text
26676934 The present study demonstrated that the antiapoptotic effect of TMP in CoCl2-induced HUVECs was, at least in part, via the regulation of the PHD2/HIF-1alpha signaling pathway.
26323721 findings show hypoxia and loss of PHD2 revert cancer-associated fibroblast (CAF) activation
26267649 In this article, UTMD/PEI mediated gene transfection was investigated and the US parameters were optimized. Furthermore, the biological effects of PHD2 shRNA were investigated in H9C2 cells.
26205124 the levels of both miR-182 and HIF1alpha were elevated, while the expression PHD2 and FIH1 was downregulated in a mouse model of prostate cancer.
26112411 The kinetic properties of PHD2 and FIH with respect to oxygen reflect their cellular hypoxia-sensing ability.
26047609 a genetic link between EGLN1 and VWF in a constitution specific manner which could modulate thrombosis/bleeding susceptibility and outcomes of hypoxia, is reported.
25546659 Compared to those with high PHD2 expressions, patients with low PHD2 expression had significantly longer DFS and OS periods.
25431923 The association between EGLN1 and HIF-1AN single nucleotide polymorphisms and acute mountain sickness in a Han Chinese population, was examined.
25420025 Data show that dimethyl-2-ketoglutarate (DKG) inhibits hypoxia-inducible factor 1alpha (HIF-1alpha) proline hydroxylation and degradation mediated by prolyl-4-hydroxylase PHD2.
25263965 Germ-line PHD1 and PHD2 mutations detected in patients with pheochromocytoma/paraganglioma-polycythemia
More...

AA Sequence

MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVG      1 - 70
PHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAA     71 - 140
EAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVV    141 - 210
DDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLI    211 - 280
RHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGK    281 - 350
AQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS    351 - 420
VGKDVF                                                                    421 - 426
//

Text Mined References (131)

PMID Year Title
26676934 2016 Tetramethylpyrazine protects CoCl2-induced apoptosis in human umbilical vein endothelial cells by regulating the PHD2/HIF/1?-VEGF pathway.
26323721 2015 Hypoxia and loss of PHD2 inactivate stromal fibroblasts to decrease tumour stiffness and metastasis.
26267649 2015 Ultrasound-targeted microbubble destruction (UTMD) assisted delivery of shRNA against PHD2 into H9C2 cells.
26205124 2015 Hypoxia-inducible miR-182 enhances HIF1? signaling via targeting PHD2 and FIH1 in prostate cancer.
26112411 2015 Kinetic Investigations of the Role of Factor Inhibiting Hypoxia-inducible Factor (FIH) as an Oxygen Sensor.
26047609 2015 Combined genetic effects of EGLN1 and VWF modulate thrombotic outcome in hypoxia revealed by Ayurgenomics approach.
25974097 2015 Myeloid translocation gene-16 co-repressor promotes degradation of hypoxia-inducible factor 1.
25546659 2014 Tumor PHD2 expression is correlated with clinical features and prognosis of patients with HCC receiving liver resection.
25431923 2014 Variants of the low oxygen sensors EGLN1 and HIF-1AN associated with acute mountain sickness.
25420025 2014 Intermediary metabolite precursor dimethyl-2-ketoglutarate stabilizes hypoxia-inducible factor-1? by inhibiting prolyl-4-hydroxylase PHD2.
More...