Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.500 3.9e-02
astrocytic glioma 1.200 1.6e-02
ependymoma 1.500 1.5e-02
group 3 medulloblastoma 1.100 2.2e-03
intraductal papillary-mucinous adenoma (... 1.200 4.1e-04
juvenile dermatomyositis 1.028 2.1e-09
Multiple myeloma 1.174 2.7e-03
oligodendroglioma 1.400 1.1e-02
osteosarcoma 1.266 2.8e-04
ovarian cancer -1.100 1.0e-10
primitive neuroectodermal tumor 1.300 1.9e-05
subependymal giant cell astrocytoma 1.352 3.2e-02

Gene RIF (1)

AA Sequence

MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRREFFTTTTKEGYDRRPVDITPLEQRKLTFDTHALVQDL      1 - 70
ETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLDAIRKDMVILEKSEFANLRAE     71 - 140
NEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETS    141 - 210
NKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIALGFYRFWK                              211 - 254
//

Text Mined References (15)

PMID Year Title