Property Summary

NCBI Gene PubMed Count 43
PubMed Score 413.77
PubTator Score 123.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.27691068684075E-8
pituitary cancer 1972 1.77889804456523E-4
lung cancer 4473 2.41540579341164E-4
osteosarcoma 7933 0.00141883935251153
psoriasis 6685 0.00168071169496612
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00173007326599664
aldosterone-producing adenoma 664 0.00962091692188409
medulloblastoma, large-cell 6234 0.0112295358687677
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0128307966012921
group 3 medulloblastoma 2254 0.0242872230169012
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0

Expression

Synonym

Accession Q9GZT4 D3DTI5 Q6IA55
Symbols ILV1
ISO1

Gene

SRR

PANTHER Protein Class (2)

PDB

3L6B   3L6R  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (28)

PMID Text
26913720 MiR-193a-3p and miR-193a-5p play important roles in osteosarcoma metastasis through down-regulation of the Rab27B and SRR genes and therefore may serve as useful biomarkers for the diagnosis of osteosarcoma
26485193 Loss-of-function mutation of the gene encoding serine racemase significantly attenuates excitotoxicity in retina.
25493718 In serine racemase, similarly to the related enzyme alanine racemase, the unprotonated pyridoxal-5'-phosphate -substrate intermediate is stabilized mostly due to solvation effects contributed by water molecules and active-site residues.
25336657 FBXO22 protein is required for optimal synthesis of NMDA receptor coagonist D-serine by interacting with serine racemase, activating it, and preventing its targeting to membranes.
25331425 Serine racemase activity and dynamics are regulated by halides, ATP and malonate.
23992455 cross-talk between allosteric and active sites, leading to the stabilization of two alternative protein conformations with ATP affinities of ~ 10 muM and 1.8 mm
23112234 S84A serine racemase mutant behaved like serine dehydratase, whereas A65S serine dehydratase mutant acquired an additional function of using D-serine as a substrate.
22151352 The structural characteristics of SR obtained from live cells suggest that SR is sensitive to oxidation in vivo, perhaps consistent with a scenario in which such modification plays a role in feedback or other forms of regulation.
22117694 Serine racemase and D-serine are involved in both pre-symptomatic and progressive phases of amyotrophic lateral sclerosis, demonstrating a link between mutant superoxide dismutase (SOD)1 and a glial-derived toxic mediator in transgenic mice.
22096510 Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women.
More...

AA Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD      1 - 70
ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK     71 - 140
RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE    141 - 210
PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL    211 - 280
LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV              281 - 340
//

Text Mined References (43)

PMID Year Title
26913720 2016 MiR-193a-3p and miR-193a-5p suppress the metastasis of human osteosarcoma cells by down-regulating Rab27B and SRR, respectively.
26485193 2016 Loss-of-function mutation of serine racemase attenuates excitotoxicity by intravitreal injection of N-methyl-D-aspartate.
25493718 2015 Understanding the reaction mechanism and intermediate stabilization in mammalian serine racemase using multiscale quantum-classical simulations.
25336657 2014 FBXO22 protein is required for optimal synthesis of the N-methyl-D-aspartate (NMDA) receptor coagonist D-serine.
25331425 2015 Regulation of human serine racemase activity and dynamics by halides, ATP and malonate.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23992455 2013 ATP binding to human serine racemase is cooperative and modulated by glycine.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23112234 2012 Modulating the function of human serine racemase and human serine dehydratase by protein engineering.
More...