Property Summary

NCBI Gene PubMed Count 46
PubMed Score 451.27
PubTator Score 123.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.091 9.6e-03
ependymoma 1.300 2.7e-07
group 3 medulloblastoma 1.200 2.4e-02
intraductal papillary-mucinous carcinoma... -1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02
lung cancer 1.700 2.4e-04
medulloblastoma, large-cell -1.600 1.1e-02
osteosarcoma -2.119 6.7e-04
pituitary cancer 1.300 1.8e-04
psoriasis -1.500 1.7e-03

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD      1 - 70
ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK     71 - 140
RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE    141 - 210
PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL    211 - 280
LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV              281 - 340
//

Text Mined References (46)

PMID Year Title