Property Summary

NCBI Gene PubMed Count 18
PubMed Score 23.60
PubTator Score 10.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.549 0.001
astrocytoma -1.500 0.005
pancreatic ductal adenocarcinoma liver m... -1.428 0.045
intraductal papillary-mucinous neoplasm ... 1.300 0.001
lung cancer 2.100 0.000
breast carcinoma 1.400 0.002
psoriasis 1.200 0.000
Polycystic Ovary Syndrome 1.359 0.006
ovarian cancer 2.500 0.000
dermatomyositis 1.100 0.003

Synonym

Accession Q9GZT3 J3KMY7
Symbols DC50
PD04872
C14orf156

Gene

Gene RIF (6)

PMID Text
22661577 The LRPPRC/SLIRP complex suppressed 3' exonucleolytic mRNA degradation mediated by PNPase and SUV3.
22190034 HIV-1 Vpu is identified to have a physical interaction with SRA stem-loop interacting RNA binding protein (SLIRP) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20200222 LRPPRC exists in a high-molecular-weight complex, and it coimmunoprecipitates with SLIRP, a stem-loop RNA-binding protein.
19680543 SLIRP plays an essential role in maintaining mitochondrial-localized mRNA transcripts that encode OxPhos protein subunits.
16762838 Our data demonstrate that SLIRP modulates NR transactivation, suggest it may regulate mitochondrial function, and provide mechanistic insight into interactions between SRA, SLIRP, SRC-1, and NCoR.

AA Sequence

MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE      1 - 70
EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF                                    71 - 109
//

Text Mined References (26)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22661577 2012 LRPPRC/SLIRP suppresses PNPase-mediated mRNA decay and promotes polyadenylation in human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22045337 2012 LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...