Property Summary

NCBI Gene PubMed Count 20
PubMed Score 29.93
PubTator Score 10.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.500 5.2e-03
breast carcinoma 1.400 1.8e-03
dermatomyositis 1.100 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.300 7.5e-04
lung cancer 2.100 9.8e-05
Multiple myeloma 1.549 7.2e-04
ovarian cancer 2.500 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.428 4.5e-02
Polycystic ovary syndrome 1.359 6.2e-03
psoriasis 1.200 2.0e-13

Gene RIF (8)

AA Sequence

MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE      1 - 70
EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF                                    71 - 109
//

Text Mined References (28)

PMID Year Title