Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.99
PubTator Score 13.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
CILIARY DYSKINESIA, PRIMARY, 9 1 0.0 0.0
Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.5e-06
ependymoma 4679 1.4e-04
chronic rhinosinusitis 512 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Situs Inversus 65 4.537 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.575 3.1e-02
ependymoma 1.700 1.4e-04
nasopharyngeal carcinoma -2.300 1.5e-06

Gene RIF (2)

AA Sequence

MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEME      1 - 70
TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAM     71 - 140
EVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPE    141 - 210
LALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTEC    211 - 280
FSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAK    281 - 350
TSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRP    351 - 420
TVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQR    421 - 490
NEKNVASSMFERETRREKILEARHREMRLKEKGKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAEL    491 - 560
KKKEADAIKLTPVPQQPSPEEDQVVEEGEEAAGEEGDEEVEEDLA                             561 - 605
//

Text Mined References (13)

PMID Year Title