Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.35
PubTator Score 13.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 3.100 0.000
nasopharyngeal carcinoma -2.300 0.000
chronic rhinosinusitis -1.575 0.031

Synonym

Accession Q9GZS0 C9J0S6 Q8IUW4 Q9H179 Q9NT53
Symbols DIC2
CILD9

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18950741 DNAI2 mutations cause primary ciliary dyskinesia with defects in the outer dynein arm.

AA Sequence

MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEME      1 - 70
TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAM     71 - 140
EVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPE    141 - 210
LALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTEC    211 - 280
FSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAK    281 - 350
TSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRP    351 - 420
TVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQR    421 - 490
NEKNVASSMFERETRREKILEARHREMRLKEKGKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAEL    491 - 560
KKKEADAIKLTPVPQQPSPEEDQVVEEGEEAAGEEGDEEVEEDLA                             561 - 605
//

Text Mined References (13)

PMID Year Title
25232951 2014 HEATR2 plays a conserved role in assembly of the ciliary motile apparatus.
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
23849778 2013 ARMC4 mutations cause primary ciliary dyskinesia with randomization of left/right body asymmetry.
23261302 2013 Exome sequencing identifies mutations in CCDC114 as a cause of primary ciliary dyskinesia.
21953912 2011 A unified taxonomy for ciliary dyneins.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18950741 2008 DNAI2 mutations cause primary ciliary dyskinesia with defects in the outer dynein arm.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...