Property Summary

NCBI Gene PubMed Count 49
PubMed Score 103.99
PubTator Score 76.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Stargardt disease 3 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 2.2
Disease Target Count Z-score Confidence
Age related macular degeneration 72 0.0 5.0

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.574 6.1e-03
adult high grade glioma -2.800 9.3e-06
astrocytic glioma -3.100 1.4e-03
Astrocytoma, Pilocytic -1.800 7.2e-08
Atopic dermatitis -1.600 1.1e-02
atypical teratoid / rhabdoid tumor -2.900 5.7e-07
cystic fibrosis 2.212 3.1e-07
ependymoma -3.000 2.7e-03
glioblastoma -2.400 1.5e-08
group 3 medulloblastoma -2.000 1.5e-04
malignant mesothelioma -3.500 3.3e-08
medulloblastoma, large-cell -3.500 9.3e-06
non-small cell lung cancer 1.036 1.3e-07
oligodendroglioma -1.900 2.0e-02
periodontitis -1.300 2.5e-25
Pick disease -1.400 2.6e-02
primitive neuroectodermal tumor -1.500 3.3e-03
tuberculosis -1.500 5.5e-06

Gene RIF (34)

AA Sequence

MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDR      1 - 70
EPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYL     71 - 140
DTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQK    141 - 210
YLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGK    211 - 280
TAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD                                        281 - 314
//

Text Mined References (48)

PMID Year Title