Property Summary

NCBI Gene PubMed Count 22
PubMed Score 47.76
PubTator Score 27.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.400 0.000
osteosarcoma -1.761 0.000
primitive neuroectodermal tumor 1.100 0.008
hereditary spastic paraplegia -1.032 0.009
sonic hedgehog group medulloblastoma 1.200 0.000
progressive supranuclear palsy -1.300 0.009
Breast cancer -1.700 0.000
ovarian cancer 2.600 0.000

Synonym

Accession Q9GZR1 A6NNY9 O94891 Q5VUL3 Q5VUL4 Q8TBY4 Q9UJV5
Symbols SSP1
SUSP1

Gene

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2582 summary 0 / 0 / 0 Summary assay for identification of inhibitors of Sentrin-specific protease 6 (SENP6)
2599 screening 5820 / 0 / 324660 uHTS Luminescent assay for identification of inhibitors of Sentrin-specific protease 6 (SENP6)
488915 screening 3568 / 0 / 2628 Single concentration confirmation of uHTS for inhibitors of Sentrin-specific protease 6 (SENP6) using a Luminescent assay
488921 confirmatory 597 / 0 / 107 Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 6 (SENP6) using a Luminescent assay
489001 summary 0 / 0 / 0 Summary assay for identification of pan-SENP inhibitors
504492 confirmatory 111 / 0 / 156 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 6 (SENP6) using a Luminescent assay
588598 confirmatory 45 / 0 / 53 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 6 (SENP6) using a Luminescent assay - Set 2

Gene RIF (9)

PMID Text
26164001 our data suggest that SENP6, which is highly expressed in gastric cancer cells, regulates the transcriptional activity and stability of FoxM1 through deSUMOylation.
24424631 the structure of SENP2-Loop1 in complex with SUMO2 was solved at 2.15 A resolution, and reveals the details of an interface exclusive to SENP6/7 and the formation of unique contacts between both proteins
21878624 Loop 1 insertion in SENP6 and SENP7 as a platform to discriminate between SUMO1 and SUMO2/3 isoforms in this subclass of the SUMO protease family.
21148299 study of substrate specificity of SENP6; it is also capable of cleaving mixed chains of SUMO-1 and SUMO-2/3; mutation of catalytic cysteine of results in its accumulation in PML NBs; findings indicate SUMO-modified PML is a substrate of SENP6
20212317 Results reveal a novel mechanism whereby the finely balanced activities of SENP6 and RNF4 control vertebrate kinetochore assembly through SUMO-targeted destabilization of inner plate components.
18799455 SENP6 and SENP7 exhibit lower rates for processing pre-SUMO1, pre-SUMO2, or pre-SUMO3 in comparison with SENP2
17000875 We have investigated the specificity of SUSP1 using vinyl sulfone inhibitors and model substrates. SUSP1 has a strong paralogue bias toward SUMO2/3 and acts preferentially on substrates containing three or more SUMO2/3 moieties
16912044 SUSP1 plays an important role in the control of the transcriptional activity of RXRalpha and thus in the RXRalpha-mediated cellular processes
14563852 SENP1 localization is influenced by expression and localization of SUMO-1-conjugated target proteins within the cell.

AA Sequence

MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKL      1 - 70
NRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNMLSNNKKLSENTQNTSLCSGTVVHGRRFHHA     71 - 140
HAQIPVVKTAAQSSLDRKERKEYPPHVQKVEINPVRLSRLQGVERIMKKTEESESQVEPEIKRKVQQKRH    141 - 210
CSTYQPTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNV    211 - 280
EKVPIDIIVNCDDSKHTYLQTNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRES    281 - 350
ISPQPADSACSSPAPSTGKVEAALNENTCRAERELRSIPEDSELNTVTLPRKARMKDQFGNSIINTPLKR    351 - 420
RKVFSQEPPDALALSCQSSFDSVILNCRSIRVGTLFRLLIEPVIFCLDFIKIQLDEPDHDPVEIILNTSD    421 - 490
LTKCEWCNVRKLPVVFLQAIPAVYQKLSIQLQMNKEDKVWNDCKGVNKLTNLEEQYIILIFQNGLDPPAN    491 - 560
MVFESIINEIGIKNNISNFFAKIPFEEANGRLVACTRTYEESIKGSCGQKENKIKTVSFESKIQLRSKQE    561 - 630
FQFFDEEEETGENHTIFIGPVEKLIVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLK    631 - 700
KEDADRIHIFSSFFYKRLNQRERRNHETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAV    701 - 770
VCFPGLEKPKYEPNPHYHENAVIQKCSTVEDSCISSSASEMESCSQNSSAKPVIKKMLNKKHCIAVIDSN    771 - 840
PGQEESDPRYKRNICSVKYSVKKINHTASENEEFNKGESTSQKVADRTKSENGLQNESLSSTHHTDGLSK    841 - 910
IRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILLMDSLR    911 - 980
GPSRSNVVKILREYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFE    981 - 1050
LPMNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEGTEQYVNSISD           1051 - 1112
//

Text Mined References (30)

PMID Year Title
26164001 2015 SUMO-specific protease 6 promotes gastric cancer cell growth via deSUMOylation of FoxM1.
24424631 2014 Structural insights into the SENP6 Loop1 structure in complex with SUMO2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21878624 2011 Swapping small ubiquitin-like modifier (SUMO) isoform specificity of SUMO proteases SENP6 and SENP7.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21148299 2011 The SUMO protease SENP6 is a direct regulator of PML nuclear bodies.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20705237 2010 Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.
More...