Property Summary

NCBI Gene PubMed Count 85
PubMed Score 313.84
PubTator Score 163.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.04969974877271E-20
hepatocellular carcinoma 550 1.17427581611825E-4
lung cancer 4473 1.29761731907936E-4
Atopic dermatitis 944 1.82455892835135E-4
invasive ductal carcinoma 2950 1.9981928783777E-4
ovarian cancer 8492 0.00153374030473669
Multiple myeloma 1328 0.00439052038835153
medulloblastoma, large-cell 6234 0.0065465749519099
primary pancreatic ductal adenocarcinoma 1271 0.00674575586947763
spina bifida 1064 0.0217868459461746
Disease Target Count Z-score Confidence
Cancer 2346 4.483 2.2

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma -2.000 0.000
Multiple myeloma 1.398 0.004
medulloblastoma, large-cell -1.300 0.007
Atopic dermatitis -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.201 0.007
non-small cell lung cancer -1.201 0.000
lung cancer -1.200 0.000
spina bifida -1.496 0.022
invasive ductal carcinoma -1.300 0.000
ovarian cancer 1.700 0.002

Synonym

Accession Q9GZQ8 Q6NW02
Symbols LC3B
ATG8F
MAP1LC3B-a
MAP1A/1BLC3

Gene

PDB

5D94   3WAO   2LUE   3VTV   3VTW   1V49   2ZJD   3VTU   3X0W   4WAA   5DCN  

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG

Gene RIF (52)

PMID Text
26794413 Collectively, our findings indicate that MIR494 reduces cell survival in 769-P renal cancer cells which is accompanied by increased lipid droplet formation (which occurs in a LC3B-dependent manner) and mitochondrial changes.
26719147 Loss of HPS1 protein results in impaired autophagy that is restored by exogenous LC3B and that defective autophagy might therefore play a critical role in the development and progression of Hermansky-Pudlak syndrome.
26506894 the combined positivity for LC3B(+) puncta and nuclear HMGB1 is a positive predictor for longer BC survival
26502823 In microsatellite stable carcinomas, the level of LC3B-II expression was higher than that in the microsatellite unstable carcinomas.
26486079 Data show CGK733 induced microtubule associated protein LC3B formation upstream of AMP-activated protein kinase and protein kinase RNA-like endoplasmic reticulum kinase/CCAAT-enhancer-binding protein homologous protein pathways and p21 Cip1 expression.
26468287 FYCO1 requires a functional LC3A/B-preferring LC3-interacting Region (LIR) motif to facilitate efficient maturation of autophagosomes under basal conditions, whereas starvation-induced autophagy was unaffected
25847297 HIV-1 Tat co-localizes with microtubule-associated protein 1 light chain 3 beta in neuronal cells
25653352 HIV-1 Tat co-localizes with microtubule-associated protein 1 light chain 3 beta in neuronal cells
25607473 LC3B may promote the migration and invasion of EOC cells by affecting the cytoskeleton via the RhoA pathway.
25503069 mRNA levels of MAP1LC3B, an autophagic marker, showed a 5-fold decrease in symptomatic samples.
More...

AA Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR      1 - 70
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV                    71 - 125
//

Text Mined References (96)

PMID Year Title
26794413 2016 MIR494 reduces renal cancer cell survival coinciding with increased lipid droplets and mitochondrial changes.
26719147 2016 MAP1LC3B overexpression protects against Hermansky-Pudlak syndrome type-1-induced defective autophagy in vitro.
26506894 2015 Combined evaluation of LC3B puncta and HMGB1 expression predicts residual risk of relapse after adjuvant chemotherapy in breast cancer.
26502823 2015 Autophagy is upregulated during colorectal carcinogenesis, and in DNA microsatellite stable carcinomas.
26486079 2015 CGK733-induced LC3 II formation is positively associated with the expression of cyclin-dependent kinase inhibitor p21Waf1/Cip1 through modulation of the AMPK and PERK/CHOP signaling pathways.
26468287 2015 FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25607473 2015 Inhibition of microtubule-associated protein 1 light chain 3B via small-interfering RNA or 3-methyladenine impairs hypoxia-induced HO8910PM and HO8910 epithelial ovarian cancer cell migration and invasion and is associated with RhoA and alterations of the actin cytoskeleton.
25503069 2014 Autophagic marker MAP1LC3B expression levels are associated with carotid atherosclerosis symptomatology.
25490467 2015 HIV-1 viral infectivity factor interacts with microtubule-associated protein light chain 3 and inhibits autophagy.
More...