Property Summary

NCBI Gene PubMed Count 85
Grant Count 10
R01 Count 5
Funding $779,028.97
PubMed Score 313.84
PubTator Score 163.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma -2.000 0.000
Multiple myeloma 1.398 0.004
medulloblastoma, large-cell -1.300 0.007
Atopic dermatitis -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.201 0.007
non-small cell lung cancer -1.201 0.000
lung cancer -1.200 0.000
spina bifida -1.496 0.022
invasive ductal carcinoma -1.300 0.000
ovarian cancer 1.700 0.002

Gene RIF (57)

PMID Text
26794413 Collectively, our findings indicate that MIR494 reduces cell survival in 769-P renal cancer cells which is accompanied by increased lipid droplet formation (which occurs in a LC3B-dependent manner) and mitochondrial changes.
26719147 Loss of HPS1 protein results in impaired autophagy that is restored by exogenous LC3B and that defective autophagy might therefore play a critical role in the development and progression of Hermansky-Pudlak syndrome.
26506894 the combined positivity for LC3B(+) puncta and nuclear HMGB1 is a positive predictor for longer BC survival
26502823 In microsatellite stable carcinomas, the level of LC3B-II expression was higher than that in the microsatellite unstable carcinomas.
26486079 Data show CGK733 induced microtubule associated protein LC3B formation upstream of AMP-activated protein kinase and protein kinase RNA-like endoplasmic reticulum kinase/CCAAT-enhancer-binding protein homologous protein pathways and p21 Cip1 expression.
26468287 FYCO1 requires a functional LC3A/B-preferring LC3-interacting Region (LIR) motif to facilitate efficient maturation of autophagosomes under basal conditions, whereas starvation-induced autophagy was unaffected
25847297 HIV-1 Tat co-localizes with microtubule-associated protein 1 light chain 3 beta in neuronal cells
25653352 HIV-1 Tat co-localizes with microtubule-associated protein 1 light chain 3 beta in neuronal cells
25653352 HIV-1 Tat co-localizes with microtubule-associated protein 1 light chain 3 beta in neuronal cells
25607473 LC3B may promote the migration and invasion of EOC cells by affecting the cytoskeleton via the RhoA pathway.
More...

AA Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR      1 - 70
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV                    71 - 125
//

Text Mined References (96)

PMID Year Title
26794413 2016 MIR494 reduces renal cancer cell survival coinciding with increased lipid droplets and mitochondrial changes.
26719147 2016 MAP1LC3B overexpression protects against Hermansky-Pudlak syndrome type-1-induced defective autophagy in vitro.
26506894 2015 Combined evaluation of LC3B puncta and HMGB1 expression predicts residual risk of relapse after adjuvant chemotherapy in breast cancer.
26502823 2015 Autophagy is upregulated during colorectal carcinogenesis, and in DNA microsatellite stable carcinomas.
26486079 2015 CGK733-induced LC3 II formation is positively associated with the expression of cyclin-dependent kinase inhibitor p21Waf1/Cip1 through modulation of the AMPK and PERK/CHOP signaling pathways.
26468287 2015 FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25607473 2015 Inhibition of microtubule-associated protein 1 light chain 3B via small-interfering RNA or 3-methyladenine impairs hypoxia-induced HO8910PM and HO8910 epithelial ovarian cancer cell migration and invasion and is associated with RhoA and alterations of the actin cytoskeleton.
25503069 2014 Autophagic marker MAP1LC3B expression levels are associated with carotid atherosclerosis symptomatology.
25490467 2015 HIV-1 viral infectivity factor interacts with microtubule-associated protein light chain 3 and inhibits autophagy.
More...