Property Summary

Ligand Count 21
NCBI Gene PubMed Count 12
PubMed Score 33.97
PubTator Score 20.21

Knowledge Summary

Patent (5,139)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 4.4e-09
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 0.8
Disease Target Count Z-score Confidence
Pain agnosia 104 4.362 2.2
Opiate dependence 29 3.037 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.598 4.4e-09

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVGNTLVCFIVLK      1 - 70
NRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSGLVQGMSVSASVFTLVAIAVE     71 - 140
RFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTLTVTREEHHFMVDARNRSYPLYSCWEAWPEK    141 - 210
GMRRVYTTVLFSHIYLAPLALIVVMYARIARKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFT    211 - 280
LSWLPLWALLLLIDYGQLSAPQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCP    281 - 350
RPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH    351 - 420
LPLTIPAWDI                                                                421 - 430
//

Text Mined References (13)

PMID Year Title