Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 2
Funding $266,467.2
PubMed Score 31.97
PubTator Score 20.21

Knowledge Summary

Patent (5,139)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.598 0.000

Synonym

Accession Q9GZQ6 A2RRF0 Q8NGR0 Q96RN3
Symbols NPFF1
GPR147
NPFF1R1
OT7T022

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (7)

PMID Text
26211894 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
25180599 RFRP-3/GPR147 may play secondary, modulatory roles on the regulation of pubertal development; a restraining modulatory effect of the NPVF p.I71_K72 variant on the activation of the gonadotrophic axis cannot be ruled out
22691551 ovarian RFRP-3/GPR147 signaling could contribute to normal ovarian function
22064075 In male rats, mRNA expressions of both RFRP and GPR147 increases from postnatal days 12 and 16; mRNA expression of GPR147 in female rats increases from postnatal day 16, peaking at postnatal day 28 and decreasing from postnatal day 35.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20027225 GnIH homologs in the human hypothalamus and were identified and human GnIH receptor (GPR147) mRNA expression in the hypothalamus as well as in the pituitary, was characterized.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVGNTLVCFIVLK      1 - 70
NRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSGLVQGMSVSASVFTLVAIAVE     71 - 140
RFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTLTVTREEHHFMVDARNRSYPLYSCWEAWPEK    141 - 210
GMRRVYTTVLFSHIYLAPLALIVVMYARIARKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFT    211 - 280
LSWLPLWALLLLIDYGQLSAPQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCP    281 - 350
RPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH    351 - 420
LPLTIPAWDI                                                                421 - 430
//

Text Mined References (13)

PMID Year Title
26211894 2015 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
25180599 2014 Mutational analysis of the genes encoding RFamide-related peptide-3, the human orthologue of gonadotrophin-inhibitory hormone, and its receptor (GPR147) in patients with gonadotrophin-releasing hormone-dependent pubertal disorders.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22691551 2012 The human gonadotropin-inhibitory hormone ortholog RFamide-related peptide-3 suppresses gonadotropin-induced progesterone production in human granulosa cells.
22064075 2012 Developmental changes in the mammalian gonadotropin-inhibitory hormone (GnIH) ortholog RFamide-related peptide (RFRP) and its cognate receptor GPR147 in the rat hypothalamus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20027225 2009 Identification of human GnIH homologs, RFRP-1 and RFRP-3, and the cognate receptor, GPR147 in the human hypothalamic pituitary axis.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...