Property Summary

NCBI Gene PubMed Count 16
Grant Count 23
R01 Count 5
Funding $2,082,827.42
PubMed Score 267.08
PubTator Score 42.56

Knowledge Summary

Patent (9,021)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.570 0.000
active ulcerative colitis 1.607 0.030
ovarian cancer 1.200 0.000

Gene RIF (3)

PMID Text
26317338 Study identified a novel NMUR2 splice variant lacking the third exon and able to form heteromeric complexes with NMUR1 and NMUR2 without Neuromedin U (NMU). Its expression can block NMU signaling suppressing then ovarian cancer cells proliferation.
25871004 polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.
16781063 A cell-based reporter gene assay has been developed and used for the screening of the human NMU2R agonist.

AA Sequence

MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGVIGNVLVCLVI      1 - 70
LQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTV     71 - 140
SVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLPNTSIHGIKFHYFPNGSLVPGSATCTVIKPM    141 - 210
WIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAIC    211 - 280
WAPFHIDRLFFSFVEEWSESLAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWH    281 - 350
SQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT         351 - 415
//

Text Mined References (17)

PMID Year Title
26317338 2015 Identifying a Neuromedin U Receptor 2 Splice Variant and Determining Its Roles in the Regulation of Signaling and Tumorigenesis In Vitro.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25416956 2014 A proteome-scale map of the human interactome network.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
16781063 2006 Chemical genetic analysis reveals the effects of NMU2R on the expression of peptide hormones.
15525579 2004 Studies of the neuromedin U-2 receptor gene in human obesity: evidence for the existence of two ancestral forms of the receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...