Property Summary

Ligand Count 9
NCBI Gene PubMed Count 16
PubMed Score 278.58
PubTator Score 42.56

Knowledge Summary

Patent (9,021)

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis 1.607 3.0e-02
osteosarcoma 1.570 4.9e-07
ovarian cancer 1.200 3.4e-10

Gene RIF (3)

AA Sequence

MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGVIGNVLVCLVI      1 - 70
LQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTV     71 - 140
SVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLPNTSIHGIKFHYFPNGSLVPGSATCTVIKPM    141 - 210
WIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAIC    211 - 280
WAPFHIDRLFFSFVEEWSESLAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWH    281 - 350
SQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT         351 - 415
//

Text Mined References (17)

PMID Year Title