Property Summary

Ligand Count 11
NCBI Gene PubMed Count 16
PubMed Score 278.58
PubTator Score 42.56

Knowledge Summary

Patent (9,021)

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis 1.607 3.0e-02
osteosarcoma 1.570 4.9e-07
ovarian cancer 1.200 3.4e-10

Gene RIF (3)

AA Sequence

MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGVIGNVLVCLVI      1 - 70
LQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTV     71 - 140
SVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLPNTSIHGIKFHYFPNGSLVPGSATCTVIKPM    141 - 210
WIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAIC    211 - 280
WAPFHIDRLFFSFVEEWSESLAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWH    281 - 350
SQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT         351 - 415
//

Text Mined References (17)

PMID Year Title